wave guide

of 9/9
1 Abstrak Pada Proyek Akhir ini dilakukan perancangan dan pembuatan Antena Horn Sektoral Bidang-E pada frekuensi 2,4 GHz dengan pelebaran pada arah bidang listrik sebesar 31,17 cm. Pembuatan antena dilakukan dengan tiga bahan yang berbeda yaitu aluminium,tembaga dan seng, dengan ukuran sama. Dari ketiga antena tersebut akan membandingkan dan mengevaluasi efisiensinya dengan pengukuran directivitas yang didapatkan dari gain. Dari ketiga antena tersebut akan diimplementasikan pada jaringan wireless LAN 2,4 GHz dengan menggunakan aplikasi video conference. Dari hasil pengukuran pola radiasi pada antena dengan bahan seng memiliki nilai HPBW sebesar 44° pada bidang-H, dan 42° pada bidang-E dengan direktivitas sebesar 13,48 dB, sehingga mempunyai nilai efisiensi sebesar 46,45 %.Pada antena dengan bahan aluminium pada bidang-H mempunyai nilai HPBW sebesar 42° dan pada bidang-E sebesar 39° dengan direktivitas sebesar 14,01 dB, sehingga mempunyai nilai efisiensi sebesar 65,15 %. Dan pada antena dengan bahan tembaga pada bidang-H mempunyai nilai HPBW sebesar 40° dan pada bidang- E sebesar 35° dengan direktivitas sebesar 14,69 dB, sehingga mempunyai nilai efisiensi sebesar 69,97 %. Pada aplikasi video conference menghasilkan rancangan nilai delay, jitter, dan troughput yang terjadi sesuai dengan standar ITU yang telah ditetapkan, sehingga ketiga antena tersebut masih layak digunakan untuk melakukan video conference Kata kunci – Antena Horn Sektoral Bidang-E, Circular Waveguide, Wireless LAN 2,4 GHz. 1. PENDAHULUAN Pada penelitian sebelumnya Ir. Budi Aswoyo, MT dosen politeknik Elektronika Negeri Surabaya telah melakukan penelitian dengan judul perancangan optimasi dan implementasi antena horn sektoral bidang-E pada frekuensi band-X [1]. Dalam penelitian tersebut disajikan tentang antena horn sektoral bidang-E, perancangan optimasi dan implementasinya pada frekuensi gelombang mikro (mikrowave) band- X, tepatnya 9.000 MHz. Sehingga menghasilkan pengarahan radiasi (directivity) yang optimum. Perancangan optimasi ini dilakukan dengan menggunakan algoritma genetika. Dari hasil simulasi perancangan dibuat 4 sampel antena dan diukur harga pengarahan radiasinya untuk dibandingkan dengan hasil rancangan. Antena horn sektoral bidang-E adalah antena celah (aperture antenna) berbentuk piramida yang mulutnya melebar sejajar dengan arah bidang listrik (E) dengan berbasis saluran pandu gelombang (waveguide). Antena jenis ini umumnya dioperasikan pada frekuensi gelombang mikro (microwave) di atas 1.000 MHZ. Pengarahan radiasi (directivity) dari antena ini selain tergantung dari dimensi saluran pandu gelombangnya, juga pelebaran mulut horn ke arah medan listrik-nya (jarak dari ‘virtual apex’ ke bidang aperture-nya = R dan panjang pelebaran bidang aperture ke arah medan listrik = B), hingga mencapai akumulasi ‘pase error’ yang domain untuk menghasilkan harga pengarahan radiasi yang optimum. Pada proyek akhir ini akan dibuat antena horn sektoral bidang-E dengan menggunakan tiga bahan yang berbeda yaitu aluminium,tembaga dan seng, dengan ukuran sama. Dari ketiga antena tersebut akan membandingkan dan mengevaluasi efisiensinya dengan pengukuran directivitas yang didapatkan dari gain. Pencatu (driver) antena ini menggunakan Wireless USB Adapter. 2. LANDASAN TEORI 2.1 Antena Horn Sektoral Bidang-E Antena horn sektoral bidang-E adalah antenna horn berbentuk persegi yang mana Mulut dari antena ini melebar ke arah medan listriknya (E). Dimensi pelebaran ini dinyatakan dengan . Antena ini dicatu oleh saluran pandu gelombang persegi (rectangular waveguide) dengan dimensi penampang a x b (a = panjang penampang; b = lebar penampang). Dimensi dari bidang medan magnet sama dengan panjang penampang saluran pandu gelombang PERBANDINGAN EFISIENSI ANTENA HORN SEKTORAL BIDANG-E DENGAN BERBAGAI BAHAN UNTUK APLIKASI WIRELESS LAN 2,4 GHz Anindita Kemala Hardiani ¹, Ir.Budi Aswoyo, MT ². ¹Mahasiswa Jurusan Teknik Telekomunikasi ²Politeknik Elektronika Negeri Surabaya Institut Teknologi Sepuluh Nopember, Kampus ITS, Surabaya 60111 email : [email protected]

Post on 29-Jun-2015

282 views

Category:

Documents

3 download

Embed Size (px)

TRANSCRIPT

1 Abstrak PadaProyekAkhirinidilakukanperancangan danpembuatanAntenaHornSektoralBidang-Epada frekuensi 2,4 GHz dengan pelebaran pada arah bidang listriksebesar31,17cm.Pembuatanantenadilakukan dengantigabahanyangberbedayaitu aluminium,tembagadanseng,denganukuransama. Dariketigaantenatersebutakanmembandingkandan mengevaluasiefisiensinyadenganpengukuran directivitasyangdidapatkandarigain.Dariketiga antena tersebut akan diimplementasikan pada jaringan wirelessLAN2,4GHzdenganmenggunakanaplikasi video conference. Darihasilpengukuranpolaradiasipadaantena dengan bahan sengmemiliki nilai HPBW sebesar 44 padabidang-H,dan42padabidang-Edengan direktivitassebesar13,48dB,sehinggamempunyai nilaiefisiensisebesar46,45%.Padaantenadengan bahanaluminiumpadabidang-Hmempunyainilai HPBWsebesar42danpadabidang-Esebesar39 dengandirektivitassebesar14,01dB,sehingga mempunyainilaiefisiensisebesar65,15%.Danpada antenadenganbahantembagapadabidang-H mempunyai nilai HPBW sebesar 40 dan pada bidang-Esebesar35dengandirektivitassebesar14,69dB, sehinggamempunyainilaiefisiensisebesar69,97%.Padaaplikasivideoconferencemenghasilkan rancangannilaidelay,jitter,dantroughputyang terjadisesuaidenganstandarITUyangtelah ditetapkan,sehinggaketigaantenatersebutmasih layak digunakan untuk melakukan video conference KatakunciAntenaHornSektoralBidang-E, Circular Waveguide, Wireless LAN 2,4 GHz. 1.PENDAHULUAN PadapenelitiansebelumnyaIr.Budi Aswoyo,MTdosenpoliteknikElektronika NegeriSurabayatelahmelakukanpenelitian denganjudulperancanganoptimasidan implementasi antena horn sektoral bidang-E pada frekuensiband-X[1].Dalampenelitiantersebut disajikantentangantenahornsektoralbidang-E, perancangan optimasi dan implementasinya pada frekuensigelombangmikro(mikrowave)band-X,tepatnya9.000MHz.Sehinggamenghasilkan pengarahanradiasi(directivity)yangoptimum. Perancanganoptimasiinidilakukandengan menggunakanalgoritmagenetika.Darihasil simulasi perancangan dibuat 4 sampel antena dan diukurhargapengarahanradiasinyauntuk dibandingkan dengan hasil rancangan. Antena horn sektoral bidang-E adalah antena celah(apertureantenna)berbentukpiramida yangmulutnyamelebarsejajardenganarah bidanglistrik(E)denganberbasissaluranpandu gelombang(waveguide).Antenajenisini umumnyadioperasikanpadafrekuensi gelombangmikro(microwave)diatas1.000 MHZ. Pengarahanradiasi(directivity)dariantena iniselaintergantungdaridimensisaluranpandu gelombangnya,jugapelebaranmuluthornke arahmedanlistrik-nya(jarakdarivirtualapex kebidangaperture-nya=Rdanpanjang pelebaranbidangaperturekearahmedanlistrik =B),hinggamencapaiakumulasipaseerror yangdomainuntukmenghasilkanharga pengarahan radiasi yang optimum. Padaproyekakhiriniakandibuatantena hornsektoralbidang-Edenganmenggunakan tigabahanyangberbedayaitu aluminium,tembagadanseng,denganukuran sama.Dariketigaantenatersebutakan membandingkandanmengevaluasiefisiensinya denganpengukurandirectivitasyangdidapatkan darigain.Pencatu(driver)antenaini menggunakan Wireless USB Adapter. 2. LANDASAN TEORI 2.1Antena Horn Sektoral Bidang-E Antenahornsektoralbidang-Eadalah antennahornberbentukpersegiyangmana Mulutdariantenainimelebarkearahmedan listriknya(E).Dimensipelebaraninidinyatakan denganb1.Antenainidicatuolehsaluranpandu gelombangpersegi(rectangularwaveguide) dengandimensipenampangaxb(a=panjang penampang; b = lebar penampang). Dimensi dari bidangmedanmagnetsamadenganpanjang penampangsaluranpandugelombang PERBANDINGAN EFISIENSI ANTENA HORN SEKTORAL BIDANG-EDENGAN BERBAGAI BAHANUNTUK APLIKASI WIRELESS LAN 2,4 GHz Anindita Kemala Hardiani , Ir.Budi Aswoyo, MT . Mahasiswa Jurusan Teknik Telekomunikasi Politeknik Elektronika Negeri Surabaya Institut Teknologi Sepuluh Nopember, Kampus ITS, Surabaya 60111 email : [email protected] 2 pencatunya,yaitua.JarakRdiukurdarivirtual apexdarihornkebidangaperture-nya.Bentuk dankonstruksidariantenahornsektoralbidang E dapat dilihat pada Gambar 1 [2]. Gambar 1. Geometri Antena Horn Sektoral Bidang-E Direktivitasdariantenahornsektoral bidang-Eberdasarkandimensinyadapat ditunjukkan pada Gambar 2 [2]. Gambar 2. Normalisasi directivity pada Antena Horn Sektoral Bidang E. Ketikasudutpelebaransemakin meningkat,direktivitasAntenaHornSektoral Bidang-Ejugasemakinmeningkathingga mencapainilaimaximum.Danketikamelewati nilaimaximummakanilaidirektivitasakan menurun.Directivitydarihornsectoralbidang-E dapat diperoleh dengan persamaan [2]: L= ux uES0cZ ............................... (1) B = b1x50pcx .................................. (2) 0L= 32n B......................................... (3)

dimana : b1 : pelebaran dimensi pandu gelombang kearah medan listrik (cm : panjang gelombang (cm). o : dimensi panjang waveguide (cm) 2.2Waveguide Persegi Waveguidepersegiadalahpandu gelombangdenganpenampangpersegidan modeliniseringdigunakandalampraktik.Hal inidisebabkankarenaperencanaan,analisaserta pembuatanrelatifmudah.Dalamanalisanya, waveguidepersegimemberikanhasilyang sederhanadenganmenggunakankoordinatsiku-siku (kartesian). Padawaveguidepersegimenggunakan modeIE10.Frekuensicut-offpadawaveguide persegi adalah [3] : c=12u.u0s0..................................(4)dimana : o: dimensi panjang waveguide. : permeabilitas. e: permitivitas

Panjanggelombangdalamwaveguidedapat dituliskan [3] : zg= x1-IZZ0]`................................... (5) dimana : : panjang gelombang diruang hampa (cm). z0 : Panjang Gelombang cut off(z0 = 2o). 2.3 Efisiensi Antena Ketikaantenadicatuolehsuatudaya masukanPinditerminalinput,makadaya tersebuttidakakanseluruhnyauntuk dipancarkanolehantenakeudara.Faktorrugi-rugiantennayangdisebabkanolehmaterial, sangatberpengaruhterhadapefisiensiantenna. HalinidapatditerangkanpadaGambar.3 sebagai berikut. 3 Gambar 3. Teori efisiensi antena Denganteorisalurantransmisi,daya masukanPinyangmasuktermnialantenaakan terbagimenjadiduabagian,yaituPraddanPohmic [6] , Pn=Pud +Pohmc ............................ (6) dimana Pud : daya radiasi yang dipancarkan oleh antena; Pohmc : daya akibat rugi-rugi oleh material. Sedangkan Puhmc dapat dinyatakan sebagai Pohmc= I2Rohmc ..................... (7) Definisiefisiensiantenadapatdinyatakan dengan persamaan [4]

c = PrcdPrcd+ Pchmic ......................... (8) Besarefisiensiantenaantara0sampaidengan 100 %. Untukmencaripendekatanefiseinsi antena yangberbasispadawaveguide,makaharus dicari dari asumsi rugi-rugi (losses) yang terjadi padawaveguide[5].Jikakondutivitasbahan dielektrikpengisiwaveguidesangatkecil (mendekatinol)dan/ataukonduktivitas konduktordindingwaveguidetidaktak berhingga(noninfinite),makagelombangakan teredamsecaraexponensialselamaperambatan dalam waveguide.UntukmodeTE10,pendekatanrugi-rugi dielektrik(dielectricloss)danrugi-rugidinding waveguidedinyatakansebagaiberikut.Rugi-rugidielektrikyangdiisikanpadawaveguide padafrekuensioperasiftertentudinyatakan dengan [3] , od= |udsd] +cd21-I]c10]] ]=12nIE10 od... (9) dengan, d : permeabilitas dielektrik pengisi waveguide. ed:permitivitas dielektrik pengisiwaveguide. od:konduktivitas dielektrik pengisi waveguide. c10:frekuensi cut off mode TE10. nTE10 : impedansi waveguide mode TE10. Jikawaveguideberisiudara(od =udara 0), makarugi-rugidielektrikod0).Sehingga rugi-rugiwaveguideterjadihanyakarenabahan dinding. Rugi-rugidindingwaveguide,berkaitan denganjenismaterialdidingwaveguidedan frekuensi kerja operasi f, dinyatakan dengan [6], Rohmc=n wow] ............... (10) dimana : w = permeabilitas material dinding waveguide,dan ow = konduktivitas material dinding waveguide. Sedangkanberdasarkanpersamaan(10), maka Pohmic dinyatakan dengan Pohmc= I2Rohmc=I2............ (11) Sehinggarumusanefisiensiantenadinyatakan dengan : c = PrcdPrcd+ |I2(.n]uwcw)!........... (12) Bagaimanapun juga, efisiensi ini sulit untuk dihitungsecaratepat,karenadayaradiasitotal PraddanaruspadaantenaIsulitdihitungsecara tepat . Sehingga penentuan efisiensi antena, pada umumnyadilakukandengancarapengukuran eksperimental [6].Persamaan(12),dapatdijadikan pendekatanuntukmenentukanefisiensiantena berbasiswaveguideyangdididingnyadari materialtertentu.Berdasarkanpersamaan tersebut,dapatdilihatbahwasemakintinggi nilaikonduktivitasmaterialdindingsuatu 4 antena,makasemakintingginilaiefisiensuatu antena.Sebagaiilustrasi,jikaantenatersebut terbuatdaribahandielektriksempurna(w0) [7],makanilaiefisiensie0.Artinyaantena tersebutsamasekalitidakdapatmeradiasikan gelombangradiosesuaidenganyang diharapkan.Sebaliknya,jikadindingantena terbuatdaribahansuperkonduktor(w), makanilaiefisiensie100%.Artinyaantena tersebutakanmeradiasikangelombangradio dengan sempurna, tanpa rugi-rugi ohmik. Dengan demikian dapat disimpulkan bahwa pernyataangainantenamemuatrugi-rugiohmik darimaterialantena,sedangkanuntuk direktivitas antena tidak memuat rugi-rugi [5]. 2.4Quality of Service (QoS) QualityOfService(QoS) adalah mekanismejaringanyangmemungkinkan aplikasi-aplikasiataulayanandapatberoperasi sesuaidenganyangdiharapkandengan tujuan untukmenyediakankualitaslayananyang berbeda-bedauntukberagamkebutuhanakan layanandidalamjaringanIP(InternetProtocol) [9]. Parameter-parameter QoS antara lain :a.Delay Delayadalahwaktuyangdibutuhkan untukmentransmisikandatasampaike penerima.Standardelayyangdiijinkan dalam pelaksanaan video converence adalah 400 ms dengan hasil yang sangat buruk dan tidak layak untuk diadakan video conference. b.Jitter Jittermerupakanvariasidelayyang terjadiakibatadanyaselisihwaktuatau intervalantarkedatanganpaketdi penerima.Untukstandarjitteryang diijinkan oleh ITU adalah < 75 ms [10]. c.Throughput Didalamjaringantelekomunikasi throughputadalahjumlahdatapersatuan waktuyangdikirimuntuksuatuterminal tertentudidalamsebuahjaringan,dari suatutitikjaringanatausuatutitikketitik jaringan yang lain. Untuk standar troughput yangdiijinkanolehITUadalahantara14-300 Kbps.d.Probabilitas Dropping / Packet Loss Packetlossterjadi ketikaadapeakload dancongestion(kemacetan transmisi paket akibat padatnya traffic yang harusdilayani)dalambataswaktutertentu, makaframe(gabungandatapayloaddan headeryangditransmisikan)akandibuang sebagaimana perlakuan terhadap frame data lainnyapadajarinnganberbasisIP. Sedangkan packet loss yang masih diijinkan adalah