peningkatan keterampilan senam lantai guling ......lapangan multiguna yg digunakan untuk bola...

of 118 /118
1 PENINGKATAN KETERAMPILAN SENAM LANTAI GULING DEPAN DAN GULING BELAKANG MENGGUNAKAN MEDIA VIDEO PADA SISWA KELAS XI TKJ SMK NEGERI 10 MALANG TAHUN AJARAN 2018/2019 Aiza Nirmala Hasan* Abstrak: Hasil pengamatan awal siswa kelas XI TKJ 4 SMK Negeri 10 Malang diketahui persentase ketuntasan pada guling depan hanya 40% dan pada guling belakang hanya 20%. Tujuan penelitian untuk meningkatkan keterampilan senam lantai guling depan dan guling belakang menggunakan media video siswa kelas XI TKJ SMK Negeri 10 Malang Tahun Ajaran 2018/2019. Metode yang digunakan adalah penelitian tindakan kelas (PTK). Hasil penelitian ini ditandai dengan peningkatan pada pertemuan pertama siklus 1 hasil evaluasi lembar kerja didapatkan nilai rata-rata siswa 80,1 dan pertemuan pertama siklus 2 hasil evaluasi lembar didapatkan nilai rata-rata siswa 91,9. Guling depan siklus 1 mengalami peningkatan persentase 83,3% dan siklus 2 persentase 86,6%. Sedangkan, guling belakang siklus 1 memiliki persentase 40%. Kemudian setelah melanjutkan ke siklus 2 memiliki persentase 83,3%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan media pembelajaran menggunakan video dapat meningkatkan hasil psikomotor (keterampilan) senam lantai guling depan dan guling belakang pada siswa kelas XI TKJ 4 di SMK Negeri 10 Malang. Saran peneliti bagi guru pendidikan jasmani olahraga dan kesehatan agar dapat menggunakan media pembelajaran video untuk dapat meningkatkan hasil belajar siswa. Kata Kunci: Peningkatan Keterampilan, Senam Lantai, Guling Depan, Guling Belakang Media Video. PENDAHULUAN Di zaman ini, perkembangan dunia Ilmu Pengetahuan dan Teknologi (IPTEK) yang demikian sangat mengagumkan telah dapat membawa manfaat yang sangat luar biasa bagi kemajuan peradaban umat manusia di bumi ini. Meskipun ada kelemahan dari kemajuan IPTEK, namun hal ini sekarang seolah diabaikan oleh manusia, fakta yang terjadi di lapangan tidak dipungkiri lagi IPTEK dikembangkan setiap detik dan waktu dan banyak pula pengaruhnya dalam kehidupan dimuka bumi ini. Macam-macam pekerjaan yang sebelumnya menuntut kemampuan isik yang cukup besar, kini relatif sudah bisa digantikan oleh perangkat-perangkat mesin yang berteknologi tinggi seperti komputer, video, kendaraan, tablet, handphone, dan lain sebagainya. Salah satu perkembangan dunia IPTEK yakni bahwa adanya pemanfaatan media internet yang saat ini sangat penting terutama dalam hal penyebaran informasi dan sumber pengetahuan. Pendidikan jasmani olahraga dan kesehatan adalah salah satu bidang yang tidak luput dari pemanfaatan IPTEK yakni komputer dan video. Bahkan perlu diketahui bahwa hubungan video dalam olahraga sudah ada sejak tahun 1960. Sebagai peralatan olahraga, pengobatan, dan simulasi olahraga adalah salah satu contoh diantaranya. Perkembangan IPTEK yang sangat pesatnya telah membawa kita ke dalam manfaat yang luar biasa bagi kemajuan peradaban umat manusia di berbagai aspek, tidak terkecuali dalam proses pembelajaran pendidikan jasmani olahraga dan kesehatan dalam realita yang terjadi masih ada diantara guru pendidikan jasmani olahraga dan kesehatan yang menerapkan pembelajaran tanpa memberdayakan potensi yang dimilikinya secara utuh, serta masih sedikit dalam menggunakan media dan sumber belajar yang ada, sementara materi-materi dalam pendidikan jasmani olahraga dan kesehatan dilakukan tidak hanya di dalam ruangan kelas yang dalam arti teori melainkan

Upload: others

Post on 28-Oct-2020

7 views

Category:

Documents


0 download

TRANSCRIPT

Page 1: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

2 1

PENINGKATANKETERAMPILANSENAMLANTAIGULINGDEPANDANGULINGBELAKANGMENGGUNAKANMEDIAVIDEOPADASISWAKELASXITKJSMKNEGERI10MALANG

TAHUNAJARAN2018/2019

AizaNirmalaHasan*

Abstrak: Hasil pengamatan awal siswa kelas XI TKJ 4 SMK Negeri 10 Malang diketahui persentaseketuntasanpadagulingdepanhanya40%danpadagulingbelakanghanya20%.Tujuanpenelitianuntukmeningkatkanketerampilansenamlantaigulingdepandangulingbelakangmenggunakanmediavideosiswa kelas XI TKJ SMK Negeri 10Malang Tahun Ajaran 2018/2019. Metode yang digunakan adalahpenelitiantindakankelas(PTK).Hasilpenelitianiniditandaidenganpeningkatanpadapertemuanpertamasiklus1hasilevaluasilembarkerjadidapatkannilairata-ratasiswa80,1danpertemuanpertamasiklus2hasilevaluasilembardidapatkannilairata-ratasiswa91,9.Gulingdepansiklus1mengalamipeningkatanpersentase83,3%dansiklus2persentase86,6%.Sedangkan,gulingbelakangsiklus1memilikipersentase40%.Kemudiansetelahmelanjutkankesiklus2memilikipersentase83,3%.Berdasarkanhasilpenelitiandapatdisimpulkanbahwapenggunaanmediapembelajaranmenggunakanvideodapatmeningkatkanhasilpsikomotor(keterampilan)senamlantaigulingdepandangulingbelakangpadasiswakelasXITKJ4diSMKNegeri 10 Malang. Saran peneliti bagi guru pendidikan jasmani olahraga dan kesehatan agar dapatmenggunakanmediapembelajaranvideountukdapatmeningkatkanhasilbelajarsiswa.

KataKunci:PeningkatanKeterampilan,SenamLantai,GulingDepan,GulingBelakangMediaVideo.

PENDAHULUAN

Di zaman ini, perkembangan dunia

Ilmu Pengetahuan dan Teknologi (IPTEK)

yang demikian sangat mengagumkan telah

dapat membawa manfaat yang sangat luar

biasabagikemajuanperadabanumatmanusia

di bumi ini. Meskipun ada kelemahan dari

kemajuan IPTEK, namun hal ini sekarang

seolah diabaikan oleh manusia, fakta yang

terjadidilapangantidakdipungkirilagiIPTEK

dikembangkan setiap detik dan waktu dan

banyak pula pengaruhnya dalam kehidupan

dimuka bumi ini. Macam-macam pekerjaan

yangsebelumnyamenuntutkemampuan�isik

yang cukup besar, kini relatif sudah bisa

digantikan oleh perangkat-perangkat mesin

yang berteknologi tinggi seperti komputer,

video,kendaraan,tablet,handphone,danlain

sebagainya. Salah satu perkembangan dunia

IPTEK yakni bahwa adanya pemanfaatan

media internet yang saat ini sangat penting

terutamadalamhalpenyebaraninformasidan

sumber pengetahuan. Pendidikan jasmani

olahraga dan kesehatan adalah salah satu

bidang yang tidak luput dari pemanfaatan

IPTEK yakni komputer dan video. Bahkan

perludiketahuibahwahubunganvideodalam

olahragasudahadasejaktahun1960.Sebagai

peralatanolahraga,pengobatan,dansimulasi

o lahraga adalah sa lah satu contoh

diantaranya.

Perkembangan IPTEK yang sangat

pesatnya telah membawa kita ke dalam

manfaat yang luar biasa bagi kemajuan

peradabanumatmanusiadiberbagaiaspek,

tidak terkecuali dalam proses pembelajaran

pendidikan jasmani olahraga dan kesehatan

dalamrealitayangterjadimasihadadiantara

guru pendidikan jasmani olahraga dan

kesehatan yang menerapkan pembelajaran

tanpa memberdayakan potensi yang

dimilikinya secara utuh, sertamasih sedikit

dalam menggunakan media dan sumber

belajar yang ada, sementara materi-materi

dalam pendidikan jasmani olahraga dan

kesehatan dilakukan tidak hanya di dalam

ruangankelasyangdalamartiteorimelainkan

Page 2: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

2 3

juga praktek di lapangan. Hal ini akan

menyebabkanpembelajaranmenjadikurang

efektif dan e�isien. Padahal dengan

menggunakan media yang ada sebagai

dampak dari perkembangan IPTEK maka

siswaakanlebihmudahmemahamiapayang

disampaikanolehgurusehinggaakantercipta

pembelajaran yang efektif dan e�isien.

Misalnya, dengan memanfaatkan alat

pengukur ketahanan berlari setelah siswa

mengetahuiteoritentangalattersebut.Guru

pendidikan jasmani olahraga dan kesehatan

merupakan salah satu komponen utama

dalam proses pendidikan. Oleh sebab itu,

berusahamemahamitantangandanmasalah

yang akan dihadapi oleh guru pendidikan

jasmani olahraga dan kesehatan pada masa

depan merupakan upaya yang baik untuk

mengembangkan profesionalisme guru

pendidikanjasmaniolahragadankesehatandi

zamanglobalisasi.

Pada tanggal 13 Agustus 2018

dilakukan pengamatan awal hasil pem-

belajaransiswakelasXITKJdiSMKNegeri10

Malang, Jl.RayaTlogowaru,Kedungkandang,

Malang. Dari hasil pengamatan awal dan

wawancaradengangurupendidikanjasmani

olahraga dan kesehatan kelas XI TKJ SMK

Negeri 10 Malang mengenai hasil belajar

siswadalammaterisenamlantaididapatdata

bahwamasihbanyaksiswayangmemperoleh

nilai rendah di bawah KKM terutama pada

materisenamlantaigulingdepandanguling

belakang.Gurupendidikan jasmaniolahraga

dankesehatanselamainimemberikanmateri

senam lantai dengan menggunakan metode

demonstrasi dan pembelajaran siswa lebih

banyak melakukan pembelajaran tahapan

gerakan secaramandiri denganwaktu yang

sedikit atau kurang ini menyebabkan siswa

sangatsulitmemahamitiaptahapgerakannya

dan takut untuk melakukannya. Dari hasil

pengamatan tentang sarana dan prasarana

yangtersediadisekolahuntukpembelajaran

pendidikanjasmaniolahragadankesehatandi

SMKNegeri 10Malang hanyamemiliki satu

lapanganmultigunaygdigunakanuntukbola

basket, futsal, dan bola voli ditambah lagi

adanya siswa kelas X dan XI yang sedang

melakukanpembelajaranpendidikanjasmani

olahraga dan kesehatan denganwaktu yang

bersamaan dan tidak adanya ruangan

serbaguna untuk membantu pembelajaran

pendidikan jasmani olahraga dan kesehatan

untuk pembelajaran senam lantai hanya

tersedia 2matras padapembelajaran guling

depan dan guling belakang dengan metode

pembelajaranyangdigunakanolehgurumata

pelajaran pendidikan jasmani olahraga dan

kesehatan ini sangat menghambat karena

keterbatasan waktu pembelajaran sehingga

tidak seluruh siswa maksimal untuk me-

lakukanpembelajaranini,diperparahdengan

enggannya beberapa siswi perempuan yang

melakukan pembelajaran guling depan dan

guling belakang karena takut, sedangkan

metode pembelajaran guru mengharuskan

siswa melakukan pembelajaran tahapan

gerakan yang dicontohkan secara sendiri-

sendiri. Dari permasalahan yang telah

dikemukakandiatasmakadiperlukanmetode

atauvariasiyangcocokdisetiappembelajaran.

Salah satunya dengan menggunakan alat

bantu berupa video yang setiap tahapan

gerakan pada pembelajaran senam lantai

guling depan dan guling belakang. Dengan

melaksanakan proses pembelajaran meng-

gunakan alat bantu, diharapkan akan dapat

memberikan suatu pembaharuan dalam

proses pembelajaran serta memungkinkan

siswa-siswiuntukmenjadilebihmudah,lebih

cepat, lebih bermakna, efektif, dan me-

nyenangkan dalam mempelajari materi

senam lantai guling depan dan guling

belakangyangdiberikanguru.

Berdasarkan latar belakang masalah

yangtelahdisajikan,rumusanmasalahdalam

penelitian ini adalah: 1) Bagaimana upaya

untuk meningkatkan keterampilan senam

lantai guling depan dengan mengunakan

mediavideosiswakelasXITKJSMKNegeri10

Malang Tahun Ajaran 2018/2019; 2)

Bagaimana upaya untuk meningkatkan

keterampilan senam lantai guling belakang

denganmengunakanmediavideosiswakelas

XITKJ SMKNegeri10MalangTahunAjaran

2018/2019.

Berdasarkanrumusanmasalah,maka

tujuan penelitian ini adalah untuk me-

ningkatkanketerampilansenamlantaiguling

depan dan guling belakang menggunakan

mediavideosiswakelasXITKJSMKNegeri10

MalangTahunAjaran2018/2019.

Manfaat dalam pendidikan baik

secara teoritis dan praktis. Adapunmanfaat

penelitian ini adalah sebagai berikut: 1)

Manfaatteoritis.Hasildaripenelitianinidapat

menjadi referensi yang berarti untuk

kemajuan media pembelajaran di bidang

pendidikan jasmani olahraga dan kesehatan

khusunyauntuksiswasekolahmenengahatas

maupun sekolah menengah kejuruan; 2)

Manfaat praktis: a) Bagi Siswa: Dapat

meningkatkan kemampuan keterampilan

guling depan dan guling belakang senam

lantai siswa SMKNegeri 10Malang; b)Bagi

Guru: Sebagai masukan untuk dijadikan

pedoman guru pendidikan jasmani olahraga

dan kesehatan SMK Negeri 10Malang akan

pentingnyapenggunaanmediapembelajaran

video dalam meningkatkan keterampilan

guling depan dan guling belakang materi

senamlantai;c)BagiSekolahSMKNegeri10

Malang:Penelitianinidapatdijadikansebagai

bahan referensi bagi pembina sekolah

mengenai peningkatan keterampilan senam

lantai guling depan dan guling belakang

mengunakanmediavideopadasiswakelasIX

SMK Negeri 10 Malang; d) Bagi Prodi

Pendidikan Jasmani dan Kesehatan Fakultas

Ilmu Keolahragaan Universitas Negeri

Malang:Penelitianinidapatdijadikansebagai

bahan referensi, kajian teori, maupun

kepustakaan guna memberikan bekal

informasi kepada mahasiswa Fakultas Ilmu

KeolahragaanUniversitasNegeriMalangyang

ingin meneliti keterampilan senam lantai

guling depan dan guling belakang; e) Bagi

Peneliti: Menambah wawasan dan pe-

ngetahuan bagi penelitian tentang karya

ilmiah untuk dapat dikembangkan lebih

lanjut.

Berdasarkan uraian diatas peneliti

tertarik untuk melakukan penelitian yang

melalui Penelitian Tindakan Kelas (PTK)

dengan judul “Peningkatan Keterampilan

Senam Lantai Guling Depan dan Guling

BelakangMenggunakanMediaVideopada

SiswaKelasXITKJSMKNegeri10Malang

TahunAjaran2018/2019”.

KAJIANTEORI

Pendidikan Jasmani Olahraga dan

Kesehatan

Menurut (Syarifuddin, 1997:3)

“Pendidikanjasmaniolahragadankesehatan

adalah proses intraksi antara siswa yang

dikeolah melalui aktivitas jasmani dalam

upaya membentuk manusia seutuhnya”.

Menurut (Sulistyorini,1990:10)“Pendidikan

jasmaniolahragadankesehatanadalahsuatu

proses pendidikan seorang sebagai pe-

rorangan maupun angota masyarakat yang

dilakukansecarasadardansistematismelalui

Page 3: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

2 3

juga praktek di lapangan. Hal ini akan

menyebabkanpembelajaranmenjadikurang

efektif dan e�isien. Padahal dengan

menggunakan media yang ada sebagai

dampak dari perkembangan IPTEK maka

siswaakanlebihmudahmemahamiapayang

disampaikanolehgurusehinggaakantercipta

pembelajaran yang efektif dan e�isien.

Misalnya, dengan memanfaatkan alat

pengukur ketahanan berlari setelah siswa

mengetahuiteoritentangalattersebut.Guru

pendidikan jasmani olahraga dan kesehatan

merupakan salah satu komponen utama

dalam proses pendidikan. Oleh sebab itu,

berusahamemahamitantangandanmasalah

yang akan dihadapi oleh guru pendidikan

jasmani olahraga dan kesehatan pada masa

depan merupakan upaya yang baik untuk

mengembangkan profesionalisme guru

pendidikanjasmaniolahragadankesehatandi

zamanglobalisasi.

Pada tanggal 13 Agustus 2018

dilakukan pengamatan awal hasil pem-

belajaransiswakelasXITKJdiSMKNegeri10

Malang, Jl.RayaTlogowaru,Kedungkandang,

Malang. Dari hasil pengamatan awal dan

wawancaradengangurupendidikanjasmani

olahraga dan kesehatan kelas XI TKJ SMK

Negeri 10 Malang mengenai hasil belajar

siswadalammaterisenamlantaididapatdata

bahwamasihbanyaksiswayangmemperoleh

nilai rendah di bawah KKM terutama pada

materisenamlantaigulingdepandanguling

belakang.Gurupendidikan jasmaniolahraga

dankesehatanselamainimemberikanmateri

senam lantai dengan menggunakan metode

demonstrasi dan pembelajaran siswa lebih

banyak melakukan pembelajaran tahapan

gerakan secaramandiri denganwaktu yang

sedikit atau kurang ini menyebabkan siswa

sangatsulitmemahamitiaptahapgerakannya

dan takut untuk melakukannya. Dari hasil

pengamatan tentang sarana dan prasarana

yangtersediadisekolahuntukpembelajaran

pendidikanjasmaniolahragadankesehatandi

SMKNegeri 10Malang hanyamemiliki satu

lapanganmultigunaygdigunakanuntukbola

basket, futsal, dan bola voli ditambah lagi

adanya siswa kelas X dan XI yang sedang

melakukanpembelajaranpendidikanjasmani

olahraga dan kesehatan denganwaktu yang

bersamaan dan tidak adanya ruangan

serbaguna untuk membantu pembelajaran

pendidikan jasmani olahraga dan kesehatan

untuk pembelajaran senam lantai hanya

tersedia 2matras padapembelajaran guling

depan dan guling belakang dengan metode

pembelajaranyangdigunakanolehgurumata

pelajaran pendidikan jasmani olahraga dan

kesehatan ini sangat menghambat karena

keterbatasan waktu pembelajaran sehingga

tidak seluruh siswa maksimal untuk me-

lakukanpembelajaranini,diperparahdengan

enggannya beberapa siswi perempuan yang

melakukan pembelajaran guling depan dan

guling belakang karena takut, sedangkan

metode pembelajaran guru mengharuskan

siswa melakukan pembelajaran tahapan

gerakan yang dicontohkan secara sendiri-

sendiri. Dari permasalahan yang telah

dikemukakandiatasmakadiperlukanmetode

atauvariasiyangcocokdisetiappembelajaran.

Salah satunya dengan menggunakan alat

bantu berupa video yang setiap tahapan

gerakan pada pembelajaran senam lantai

guling depan dan guling belakang. Dengan

melaksanakan proses pembelajaran meng-

gunakan alat bantu, diharapkan akan dapat

memberikan suatu pembaharuan dalam

proses pembelajaran serta memungkinkan

siswa-siswiuntukmenjadilebihmudah,lebih

cepat, lebih bermakna, efektif, dan me-

nyenangkan dalam mempelajari materi

senam lantai guling depan dan guling

belakangyangdiberikanguru.

Berdasarkan latar belakang masalah

yangtelahdisajikan,rumusanmasalahdalam

penelitian ini adalah: 1) Bagaimana upaya

untuk meningkatkan keterampilan senam

lantai guling depan dengan mengunakan

mediavideosiswakelasXITKJSMKNegeri10

Malang Tahun Ajaran 2018/2019; 2)

Bagaimana upaya untuk meningkatkan

keterampilan senam lantai guling belakang

denganmengunakanmediavideosiswakelas

XITKJ SMKNegeri10MalangTahunAjaran

2018/2019.

Berdasarkanrumusanmasalah,maka

tujuan penelitian ini adalah untuk me-

ningkatkanketerampilansenamlantaiguling

depan dan guling belakang menggunakan

mediavideosiswakelasXITKJSMKNegeri10

MalangTahunAjaran2018/2019.

Manfaat dalam pendidikan baik

secara teoritis dan praktis. Adapunmanfaat

penelitian ini adalah sebagai berikut: 1)

Manfaatteoritis.Hasildaripenelitianinidapat

menjadi referensi yang berarti untuk

kemajuan media pembelajaran di bidang

pendidikan jasmani olahraga dan kesehatan

khusunyauntuksiswasekolahmenengahatas

maupun sekolah menengah kejuruan; 2)

Manfaat praktis: a) Bagi Siswa: Dapat

meningkatkan kemampuan keterampilan

guling depan dan guling belakang senam

lantai siswa SMKNegeri 10Malang; b)Bagi

Guru: Sebagai masukan untuk dijadikan

pedoman guru pendidikan jasmani olahraga

dan kesehatan SMK Negeri 10Malang akan

pentingnyapenggunaanmediapembelajaran

video dalam meningkatkan keterampilan

guling depan dan guling belakang materi

senamlantai;c)BagiSekolahSMKNegeri10

Malang:Penelitianinidapatdijadikansebagai

bahan referensi bagi pembina sekolah

mengenai peningkatan keterampilan senam

lantai guling depan dan guling belakang

mengunakanmediavideopadasiswakelasIX

SMK Negeri 10 Malang; d) Bagi Prodi

Pendidikan Jasmani dan Kesehatan Fakultas

Ilmu Keolahragaan Universitas Negeri

Malang:Penelitianinidapatdijadikansebagai

bahan referensi, kajian teori, maupun

kepustakaan guna memberikan bekal

informasi kepada mahasiswa Fakultas Ilmu

KeolahragaanUniversitasNegeriMalangyang

ingin meneliti keterampilan senam lantai

guling depan dan guling belakang; e) Bagi

Peneliti: Menambah wawasan dan pe-

ngetahuan bagi penelitian tentang karya

ilmiah untuk dapat dikembangkan lebih

lanjut.

Berdasarkan uraian diatas peneliti

tertarik untuk melakukan penelitian yang

melalui Penelitian Tindakan Kelas (PTK)

dengan judul “Peningkatan Keterampilan

Senam Lantai Guling Depan dan Guling

BelakangMenggunakanMediaVideopada

SiswaKelasXITKJSMKNegeri10Malang

TahunAjaran2018/2019”.

KAJIANTEORI

Pendidikan Jasmani Olahraga dan

Kesehatan

Menurut (Syarifuddin, 1997:3)

“Pendidikanjasmaniolahragadankesehatan

adalah proses intraksi antara siswa yang

dikeolah melalui aktivitas jasmani dalam

upaya membentuk manusia seutuhnya”.

Menurut (Sulistyorini,1990:10)“Pendidikan

jasmaniolahragadankesehatanadalahsuatu

proses pendidikan seorang sebagai pe-

rorangan maupun angota masyarakat yang

dilakukansecarasadardansistematismelalui

Page 4: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

4 5

berbagai kegiatan jasmani dalam rangka

memperoleh peningkatan kemampuan dan

keterampilan jasmani, pertumbuhan,

kecerdasan, dan pembentukan watak”. Dari

beberapa pengertian di atas tentang

pengertianpendidikanjasmaniolahragadan

kesehatan dapat disimpulkan bahwa pen-

didikan jasmani olahraga dan kesehatan

adalah suatu pendidikan yang melibatkan

gerakdasarmanusiadanaktivitas�isikyang

dilakukansecarasadardansistematisuntuk

menjadikan manusia yang mempunyai

keterampilan, kecerdasan, pertumbuhan,

pembentukan keperibadian, dan emosional

yang dibutuhkan oleh manusia dalam

menjalankan berbagai aktivitas kehidupan

pribadi dan sosial sebagai makhluk yang

hidupdilingkunganmasyarakat.

Tujuan pendidikan jasmani olahraga

dankesehatanMenurut(Syarifuddin,1997:3)

dikelompokan menjadi empat tujuan

perkembangan,yaitu:1)Perkembangan�isik.

Tujuaniniberhubungandengankemampuan

melakukan kegiatan yang melibatkan

kekuatan-kekuatan �isikdariberbagaiorgan

tubuh seseorang (physical �itnes). 2)

Perkembangan gerak. Tujuan ini ber-

hubungan dengan kemampuan melakukan

geraksecaraefektif,e�isien,halus,indah,dan

sempurna (skill full). 3) Perkembangan

mental. Tujuan ini berhubungan dengan

kemampuan ber�ikir secara keseluruhan

pengetahuan tentang pendidikan jasmani

olahraga dan kesehatan ke dalam ling-

kungannya.4) Perkembangan sosial. Tujuan

ini berhubungan dengan kemampuan siswa

dalam menyesuaikan diri pada suatu

kelompokataumasyarakat.

SenamLantai

Senam lantai merupakan rumpun

senam,disebutsenamlantaikarenagerakan

senamdilakukandimatras.Senamlantaijuga

disebut pembelajaran bebas karena saat

melakukannya tidak diperlukan alat bebas

atau alat pembantu (Roji, 2007:112).

Sedangkan menurut (Biasworo, 2009:1)

senam lantai merupakan salah satu bagian

disiplincabangolahragasenamartistic,selain

itu senam lantai juga merupakan cabang

olahraga permainan yang sangat menarik.

Selain dilihat dari bentuk gerakan cabang

olahragainijugaterlihatsangatindah.

Gulingdepanmerupakanbergulingke

arah depan atas bagian belakang tengkuk,

punggung,pinggang,pinggulbagianbelakang

(Muhajir,2007:69).SedangkanmenurutRoji

(2007:112) guling depan adalah bergerak

dengancaramembulatkanbadansedemikan

rupa sehingga badan dapat bergerak dan

berguling secara bulat. Menurut Biasworo

(2009:76)gulingdepanadalahketerampilan

dasarsebagaipengendaliandanpenguasaan

tubuh saat melakukan gerakan putaran ke

arah depan dengan kaki ditekuk. Menurut

Muhajir (2014:78) guling depan adalah

gerakanbergulingkedepandenganbertumpu

padabagianbelakangdilakukandengandua

cara yaitu guling ke depan dan sikap awal

berdiri. Dari pendapat di atas dapat

disimpulkanbahwapengertiangulingdepan

adalah urutan gerak badan yang dilakukan

secara berguling ke arah depan dengan

tumpuan tangan dan kaki ditekuk. Untuk

melakukangerakangulingdepandiperlukan

tahapan-tahapanyangharusdilakukandalam

pembelajaran.

MenurutBiasworo(2009:76)gerakan

berguling belakang adalah keterampilan

dasarsebagaipengendaliandanpenguasaan

tubuh saat melakukan gerakan putaran ke

belakang.MenurutMuhajir(2014:79)guling

ke belakang adalah gerakan mengulingkan

badankebelakangdenganposisibadantetap

harusmembulat.Daripendapatdiatasdapat

disimpulkan bahwa pengertian guling

belakang adalah urutan gerak badan yang

dilakukan secara berguling dengan arah

belakang posisi jongkok dan berguling

membulatkebelakang. Daripendapatdiatas

dapat disimpulkan bahwa pengertian guling

belakang adalah urutan gerak badan yang

dilakukansecarabergulingkearahbelakang

dengan tumpuan tangan dan kaki ditekuk.

Untukmelakukangerakangulingbelakangdi

perlukan tahapan-tahapan yang harus

dilakukandalampembelajaran.

Mediaberasaldaribahasalatinmedius

yang berarti “tengah” atau “Perantara” yaitu

perantaraataupengantarpesandaripengirim

pesankepadapenerimapesan(AzharArsyad,

2014:3).MenurutSukiman (2012:30) fungsi

mediapembelajaranadalahpemakaianmedia

pembelajarandalamprosesbelajarmengajar

dapat membangkitkan motivasi dan

rangsangan kegiatan belajar dan bahkan

membawa pengaruh-pengaruh psikologis

terhadapsiswa.

Menurut Cheppy Riyana (2007:54)

mediavideopembelajaranadalahmediayang

menyajikan pesan-pesan pembelajaran baik

yang berisi konsep, prinsip, prosedur, dan

teoriaplikasipengetahuanuntukmembantu

pemahaman terhadap suatu mater i

pembelajaran. Video merupakan bahan

pembelajaran tampak dengar yang dapat

digunakanuntukmenyampaikanpesan-pesan

ataumateripelajaraan.

METODOLOGIPENELITIAN

Metode yang digunakan dalam

penelitian ini adalah Penelitian Tindakan

Kelas(PTK).Penelitiantindakankelasdalam

bahasa Inggris disebut dengan istilah

classroomactionresearch.MenurutSuharsimi

Arikunto dkk (2010: 74) PTK terdiri atas

rangkaian empat kegiatan yang dilakukan

dalamsiklusberulang.Empatkegiatanutama

yang ada pada setiap siklus, yaitu: a)

perencanaan,b)tindakan,c)pengamatan,d)

re�leksi.

SubjekPenelitian

Subjek penelitian adalah siswa-siswi

kelas XI TKJ SMK Negeri 10 Malang, yang

berjumlah 30 siswa. Mata pelajaran yang

menjadi sasaran penelitian adalah mata

pelajaran Pendidikan Jasmani kelas XI

khususnya pada kompetensi senam lantai

gulingdepandangulingbelakang.

DataPenelitian

Data yang diperoleh dari hasil

penelitianiniadalahdatakualitatifdandata

kuantitatif. Data kualitatif adalah data yang

diperolehdandianalisisbukandalambentuk

angka-angka melainkan dideskripsikan

dengan kata-kata yaitu hasil wawancara

terhadap guru dan siswa, hasil pengamatan

keterampilan siswa, dan hasil catatan

lapangan merupakan data kualitatif. Data

kuantitatif adalah data yang diperoleh dari

hasil perhitungan angka-angka. Data

kuantitatif berupa hasil tes evaluasi siswa

setelahmengikutipembelajaransenamlantai

guling depan dan guling belakang dengan

mediavideo.

AnalisiData

Analisis data dilakukan dalam suatu

penelitian untuk menarik kesimpulan dari

seluruhdatayangtelahdiperoleh.Data-data

yang dianalasis adalah hasil pengamatan

keterampilan siswa, hasil wawancara, hasil

catatan lapangan, dan hasil evaluasi siswa.

Page 5: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

4 5

berbagai kegiatan jasmani dalam rangka

memperoleh peningkatan kemampuan dan

keterampilan jasmani, pertumbuhan,

kecerdasan, dan pembentukan watak”. Dari

beberapa pengertian di atas tentang

pengertianpendidikanjasmaniolahragadan

kesehatan dapat disimpulkan bahwa pen-

didikan jasmani olahraga dan kesehatan

adalah suatu pendidikan yang melibatkan

gerakdasarmanusiadanaktivitas�isikyang

dilakukansecarasadardansistematisuntuk

menjadikan manusia yang mempunyai

keterampilan, kecerdasan, pertumbuhan,

pembentukan keperibadian, dan emosional

yang dibutuhkan oleh manusia dalam

menjalankan berbagai aktivitas kehidupan

pribadi dan sosial sebagai makhluk yang

hidupdilingkunganmasyarakat.

Tujuan pendidikan jasmani olahraga

dankesehatanMenurut(Syarifuddin,1997:3)

dikelompokan menjadi empat tujuan

perkembangan,yaitu:1)Perkembangan�isik.

Tujuaniniberhubungandengankemampuan

melakukan kegiatan yang melibatkan

kekuatan-kekuatan �isikdariberbagaiorgan

tubuh seseorang (physical �itnes). 2)

Perkembangan gerak. Tujuan ini ber-

hubungan dengan kemampuan melakukan

geraksecaraefektif,e�isien,halus,indah,dan

sempurna (skill full). 3) Perkembangan

mental. Tujuan ini berhubungan dengan

kemampuan ber�ikir secara keseluruhan

pengetahuan tentang pendidikan jasmani

olahraga dan kesehatan ke dalam ling-

kungannya.4) Perkembangan sosial. Tujuan

ini berhubungan dengan kemampuan siswa

dalam menyesuaikan diri pada suatu

kelompokataumasyarakat.

SenamLantai

Senam lantai merupakan rumpun

senam,disebutsenamlantaikarenagerakan

senamdilakukandimatras.Senamlantaijuga

disebut pembelajaran bebas karena saat

melakukannya tidak diperlukan alat bebas

atau alat pembantu (Roji, 2007:112).

Sedangkan menurut (Biasworo, 2009:1)

senam lantai merupakan salah satu bagian

disiplincabangolahragasenamartistic,selain

itu senam lantai juga merupakan cabang

olahraga permainan yang sangat menarik.

Selain dilihat dari bentuk gerakan cabang

olahragainijugaterlihatsangatindah.

Gulingdepanmerupakanbergulingke

arah depan atas bagian belakang tengkuk,

punggung,pinggang,pinggulbagianbelakang

(Muhajir,2007:69).SedangkanmenurutRoji

(2007:112) guling depan adalah bergerak

dengancaramembulatkanbadansedemikan

rupa sehingga badan dapat bergerak dan

berguling secara bulat. Menurut Biasworo

(2009:76)gulingdepanadalahketerampilan

dasarsebagaipengendaliandanpenguasaan

tubuh saat melakukan gerakan putaran ke

arah depan dengan kaki ditekuk. Menurut

Muhajir (2014:78) guling depan adalah

gerakanbergulingkedepandenganbertumpu

padabagianbelakangdilakukandengandua

cara yaitu guling ke depan dan sikap awal

berdiri. Dari pendapat di atas dapat

disimpulkanbahwapengertiangulingdepan

adalah urutan gerak badan yang dilakukan

secara berguling ke arah depan dengan

tumpuan tangan dan kaki ditekuk. Untuk

melakukangerakangulingdepandiperlukan

tahapan-tahapanyangharusdilakukandalam

pembelajaran.

MenurutBiasworo(2009:76)gerakan

berguling belakang adalah keterampilan

dasarsebagaipengendaliandanpenguasaan

tubuh saat melakukan gerakan putaran ke

belakang.MenurutMuhajir(2014:79)guling

ke belakang adalah gerakan mengulingkan

badankebelakangdenganposisibadantetap

harusmembulat.Daripendapatdiatasdapat

disimpulkan bahwa pengertian guling

belakang adalah urutan gerak badan yang

dilakukan secara berguling dengan arah

belakang posisi jongkok dan berguling

membulatkebelakang. Daripendapatdiatas

dapat disimpulkan bahwa pengertian guling

belakang adalah urutan gerak badan yang

dilakukansecarabergulingkearahbelakang

dengan tumpuan tangan dan kaki ditekuk.

Untukmelakukangerakangulingbelakangdi

perlukan tahapan-tahapan yang harus

dilakukandalampembelajaran.

Mediaberasaldaribahasalatinmedius

yang berarti “tengah” atau “Perantara” yaitu

perantaraataupengantarpesandaripengirim

pesankepadapenerimapesan(AzharArsyad,

2014:3).MenurutSukiman (2012:30) fungsi

mediapembelajaranadalahpemakaianmedia

pembelajarandalamprosesbelajarmengajar

dapat membangkitkan motivasi dan

rangsangan kegiatan belajar dan bahkan

membawa pengaruh-pengaruh psikologis

terhadapsiswa.

Menurut Cheppy Riyana (2007:54)

mediavideopembelajaranadalahmediayang

menyajikan pesan-pesan pembelajaran baik

yang berisi konsep, prinsip, prosedur, dan

teoriaplikasipengetahuanuntukmembantu

pemahaman terhadap suatu mater i

pembelajaran. Video merupakan bahan

pembelajaran tampak dengar yang dapat

digunakanuntukmenyampaikanpesan-pesan

ataumateripelajaraan.

METODOLOGIPENELITIAN

Metode yang digunakan dalam

penelitian ini adalah Penelitian Tindakan

Kelas(PTK).Penelitiantindakankelasdalam

bahasa Inggris disebut dengan istilah

classroomactionresearch.MenurutSuharsimi

Arikunto dkk (2010: 74) PTK terdiri atas

rangkaian empat kegiatan yang dilakukan

dalamsiklusberulang.Empatkegiatanutama

yang ada pada setiap siklus, yaitu: a)

perencanaan,b)tindakan,c)pengamatan,d)

re�leksi.

SubjekPenelitian

Subjek penelitian adalah siswa-siswi

kelas XI TKJ SMK Negeri 10 Malang, yang

berjumlah 30 siswa. Mata pelajaran yang

menjadi sasaran penelitian adalah mata

pelajaran Pendidikan Jasmani kelas XI

khususnya pada kompetensi senam lantai

gulingdepandangulingbelakang.

DataPenelitian

Data yang diperoleh dari hasil

penelitianiniadalahdatakualitatifdandata

kuantitatif. Data kualitatif adalah data yang

diperolehdandianalisisbukandalambentuk

angka-angka melainkan dideskripsikan

dengan kata-kata yaitu hasil wawancara

terhadap guru dan siswa, hasil pengamatan

keterampilan siswa, dan hasil catatan

lapangan merupakan data kualitatif. Data

kuantitatif adalah data yang diperoleh dari

hasil perhitungan angka-angka. Data

kuantitatif berupa hasil tes evaluasi siswa

setelahmengikutipembelajaransenamlantai

guling depan dan guling belakang dengan

mediavideo.

AnalisiData

Analisis data dilakukan dalam suatu

penelitian untuk menarik kesimpulan dari

seluruhdatayangtelahdiperoleh.Data-data

yang dianalasis adalah hasil pengamatan

keterampilan siswa, hasil wawancara, hasil

catatan lapangan, dan hasil evaluasi siswa.

Page 6: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

6 7

Databerupahasilpengamatanaktivitasguru,

hasilwawancara,danhasilcatatan lapangan

dianalisis berupa deskripsi dalam bentuk

penarikan kesimpulan. Data hasil evaluasi

siswa dan hasil pengamatan keterampilan

siswadianalisisdenganangka-angka.

HASILPENELITIANDANPEMBAHASAN

HasilPenelitian

Dari hasil tes keterampilan kondisi

awal siswa kelas XI TKJ 4 SMK Negeri 10

Malang tersebut dapat diketahui bahwa

persentase siswayangmencapaiketuntasan

padagulingdepanhanya40%(sebanyak12

siswa)danpadagulingbelakanghanya20%

(sebanyak6siswa)danyangtidakmencapai

ketuntasan pada guling depan yaitu 60%

(sebanyak 18 siswa) sedangkan, yang tidak

mencapai ketuntasan pada guling belakang

yaitu 80% (sebanyak 24 siswa). Hal ini

membuktikan bahwa hasil belajar siswa

dalam pembelajaran pendidikan jasmani

olahragadankesehatanmasihsangatrendah.

Berdasarkanhasiltessiklus1diperolehnilai

rata-rata guling depan sebesar 79,4. Jumlah

siswayangmencapaiKKMsebanyak25siswa

(83,3%)dansiswayangbelummencapaiKKM

sebanyak 5 siswa (16,6%). Sedangkan nilai

rata-ratagulingbelakangsebesar67,3.Jumlah

siswayangmencapaiKKMsebanyak12siswa

(40%)dansiswayangbelummencapaiKKM

sebanyak18siswa(60%).Hasilbelajarsenam

lantai guling depan dan guling belakang

menunjukanmasihadabeberapasiswayang

masihmengalamikesulitandalammelakukan

gerakansenamlantaigulingdepandanguling

belakangterutamadalammelakukangerakan

berguling kebelakang, karenapada siklus1

siswa belum memenuhi ketercapaian KKM,

yaitu sebesar 70% siswa yang tuntas,maka

penelitiandilanjutkanpadasiklus2.

Berdasarkan hasil tes siklus 2

diperolehnilairata-ratagulingdepansebesar

81,9. Jumlah siswa yang mencapai KKM

sebanyak 26 siswa (86.6%) dan siswa yang

belum mencapai KKM sebanyak 4 siswa

(13,3%). Sedangkan nilai rata-rata guling

belakang sebesar 76,6. Jumlah siswa yang

mencapai KKM sebanyak 25 siswa (83,3%)

dan siswa yang belum mencapai KKM

sebanyak5siswa(16,6%).Berdasarkanhasil

tes tersebut, siswa sudah memenuhi

ketercapaianKKM,yaitu sebesar70%siswa

yang tuntas, maka penelitian dianggap

berhasil.

Pembahasan

Berdasarkanpaparandatajenis-jenis

media video yang telah digunakan oleh

peneliti disesuaikan dengan tujuan yaitu

penelitian ini adalah untuk meningkatkan

keterampilansenamlantaigulingdepandan

guling belakang menggunakan media video

siswa kelas XI TKJ SMK Negeri 10 Malang

TahunAjaran2018/2019.

Dalamhalinimenggunakanmedia

videodapatdigunakanuntukmeningkatkan

keterampilansenamlantaigulingdepandan

guling belakang. Menurut Cheppy Riyana

(2007:54)mediavideopembelajaranadalah

media yang menyajikan pesan-pesan

pembelajaran baik yang berisi konsep,

prinsip, prosedur, dan teori aplikasi pe-

ngetahuan untuk membantu pemahaman

terhadap suatu materi pembelajaran. Video

merupakan bahan pembelajaran tampak

dengar yang dapat digunakan untuk

menyampaikan pesan-pesan atau materi

pelajaran. Video yaitu bahan pembelajaran

yang dikemas melalui pita video dan dapat

dilihatmelaluiVCDplayeryangdihubungkan

ke monitor televisi (Sungkono, 2003:65).

Materi yang akan disampaikan pada

pembelajaran yaitu (1) senam lantai guling

depandan(2)senamlantaigulingbelakang.

Dilihatdariaspekketerampilansiswaterjadi

peningkatan setelah diberi tindakan

berdasarkan data di pertemuan ketiga telah

diketahui awalan, gerakan berguling, dan

sikap akhir sudah mengalami perbaikan

daripada pengamatan awal. Tetapi gerakan

senamlantaigulingbelakangtidakdilakukan

dengan baik. Sedangkan menurut Roji

(2007:113)yangdimaksuddenganberguling

kebelakangadalahgerakanbadanberguling

ke arah belakang melalui bagian belakang

badan mulai dari pinggul bagian belakang,

pinggang,punggung,dantengkak.

Dilihatdarikondisiawalselainhasil

persentase dan nilai rata-rata siswa me-

ngalami peningkatan hasil tes keterampilan

siswapadapertemuanketigapada siklus1

diperoleh juga hasil pengamatan dibuat

menggunakan kriteria penilaian supaya

mudah dalam menyimpulkan hasil pe-

ngamatan. berdasarkan hasil tes siklus 1

diperolehnilairata-ratagulingdepansebesar

79,4. Jumlah siswa yang mencapai KKM

sebanyak 25 siswa (83,3%) dan siswa yang

belum mencapai KKM sebanyak 5 siswa

(16,6%). Sedangkan nilai rata-rata guling

belakang sebesar 67,3. Jumlah siswa yang

mencapaiKKMsebanyak12siswa(40%)dan

siswayangbelummencapaiKKMsebanyak18

siswa(60%).Hasilbelajarsenamlantaiguling

depan dan guling belakang menunjukan

masih ada beberapa siswa yang masih

mengalami kesulitan dalam melakukan

gerakansenamlantaigulingdepandanguling

belakangterutamadalammelakukangerakan

berguling kebelakang, karenapada siklus1

siswa belum memenuhi ketercapaian KKM,

yaitu sebesar 70% siswa yang tuntas,maka

penelitiandilanjutkanpadasiklus2.

Peningkatanhasilpembelajaransenam

lantai guling depan dan guling belakang

menggunakanmediavideopadasiswakelas

XI TKJ 4 SMK Negeri 10 Malang, ditandai

denganpeningkatannilairata-ratasiswadan

persentase ketuntasan hasil tes siswa. Nilai

rata-ratagulingdepanpadakondisiawalyaitu

69.5 dan persentase ketuntasan hasil tes

siswasenamlantaigulingdepansiswapada

kondisi awal sebesar 40% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

padasiklus1yaitu79.4dengan persentase

ketuntasan sebesar 83.3% dan siklus 2

mengalami peningkatan nilai rata-rata yaitu

81.9 dengan persentase ketuntasan sebesar

86.6%. Sedangkan, peningkatan juga terjadi

pada nilai rata-rata hasil tes senam lantai

gulingbelakangdengankodisiawalyaitu66.5

dengan persentase 20% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus 1 yaitu 67 dengan persentase

ketuntasan sebesar 40%. Namun, pe-

ningkatan tersebut masih belum mencapai

target yang ditetapkan sebelumnya. Ke-

mudiansetelahmelanjutkankesiklus2nilai

rata-ratasiswamengalamipeningkatanyaitu

76.6dengan persentaseketuntasansebesar

83.3%. Hal tersebut menunjukkan bahwa

target yang telah ditetapkan sebelumnya

sudahtercapaisehinggapenelitiandihentikan

pada siklus 2. Proses pembelajaran senam

lantai guling depan dan guling belakang

menggunakanmediavideopadasiswakelas

XITKJ4SMKNegeri10Malangberlangsung

dinamis dan menyenangkan, serta karakter

siswa dari tanggung jawab, percaya diri,

kompetitif, dan semangat jugameningkat di

setiap pertemuan. Siswa aktif mematuhi

perintah dan mengamati gerakan guling

depandangulingbelakang.Dengandemikian

Page 7: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

6 7

Databerupahasilpengamatanaktivitasguru,

hasilwawancara,danhasilcatatan lapangan

dianalisis berupa deskripsi dalam bentuk

penarikan kesimpulan. Data hasil evaluasi

siswa dan hasil pengamatan keterampilan

siswadianalisisdenganangka-angka.

HASILPENELITIANDANPEMBAHASAN

HasilPenelitian

Dari hasil tes keterampilan kondisi

awal siswa kelas XI TKJ 4 SMK Negeri 10

Malang tersebut dapat diketahui bahwa

persentase siswayangmencapaiketuntasan

padagulingdepanhanya40%(sebanyak12

siswa)danpadagulingbelakanghanya20%

(sebanyak6siswa)danyangtidakmencapai

ketuntasan pada guling depan yaitu 60%

(sebanyak 18 siswa) sedangkan, yang tidak

mencapai ketuntasan pada guling belakang

yaitu 80% (sebanyak 24 siswa). Hal ini

membuktikan bahwa hasil belajar siswa

dalam pembelajaran pendidikan jasmani

olahragadankesehatanmasihsangatrendah.

Berdasarkanhasiltessiklus1diperolehnilai

rata-rata guling depan sebesar 79,4. Jumlah

siswayangmencapaiKKMsebanyak25siswa

(83,3%)dansiswayangbelummencapaiKKM

sebanyak 5 siswa (16,6%). Sedangkan nilai

rata-ratagulingbelakangsebesar67,3.Jumlah

siswayangmencapaiKKMsebanyak12siswa

(40%)dansiswayangbelummencapaiKKM

sebanyak18siswa(60%).Hasilbelajarsenam

lantai guling depan dan guling belakang

menunjukanmasihadabeberapasiswayang

masihmengalamikesulitandalammelakukan

gerakansenamlantaigulingdepandanguling

belakangterutamadalammelakukangerakan

berguling kebelakang, karenapada siklus1

siswa belum memenuhi ketercapaian KKM,

yaitu sebesar 70% siswa yang tuntas,maka

penelitiandilanjutkanpadasiklus2.

Berdasarkan hasil tes siklus 2

diperolehnilairata-ratagulingdepansebesar

81,9. Jumlah siswa yang mencapai KKM

sebanyak 26 siswa (86.6%) dan siswa yang

belum mencapai KKM sebanyak 4 siswa

(13,3%). Sedangkan nilai rata-rata guling

belakang sebesar 76,6. Jumlah siswa yang

mencapai KKM sebanyak 25 siswa (83,3%)

dan siswa yang belum mencapai KKM

sebanyak5siswa(16,6%).Berdasarkanhasil

tes tersebut, siswa sudah memenuhi

ketercapaianKKM,yaitu sebesar70%siswa

yang tuntas, maka penelitian dianggap

berhasil.

Pembahasan

Berdasarkanpaparandatajenis-jenis

media video yang telah digunakan oleh

peneliti disesuaikan dengan tujuan yaitu

penelitian ini adalah untuk meningkatkan

keterampilansenamlantaigulingdepandan

guling belakang menggunakan media video

siswa kelas XI TKJ SMK Negeri 10 Malang

TahunAjaran2018/2019.

Dalamhalinimenggunakanmedia

videodapatdigunakanuntukmeningkatkan

keterampilansenamlantaigulingdepandan

guling belakang. Menurut Cheppy Riyana

(2007:54)mediavideopembelajaranadalah

media yang menyajikan pesan-pesan

pembelajaran baik yang berisi konsep,

prinsip, prosedur, dan teori aplikasi pe-

ngetahuan untuk membantu pemahaman

terhadap suatu materi pembelajaran. Video

merupakan bahan pembelajaran tampak

dengar yang dapat digunakan untuk

menyampaikan pesan-pesan atau materi

pelajaran. Video yaitu bahan pembelajaran

yang dikemas melalui pita video dan dapat

dilihatmelaluiVCDplayeryangdihubungkan

ke monitor televisi (Sungkono, 2003:65).

Materi yang akan disampaikan pada

pembelajaran yaitu (1) senam lantai guling

depandan(2)senamlantaigulingbelakang.

Dilihatdariaspekketerampilansiswaterjadi

peningkatan setelah diberi tindakan

berdasarkan data di pertemuan ketiga telah

diketahui awalan, gerakan berguling, dan

sikap akhir sudah mengalami perbaikan

daripada pengamatan awal. Tetapi gerakan

senamlantaigulingbelakangtidakdilakukan

dengan baik. Sedangkan menurut Roji

(2007:113)yangdimaksuddenganberguling

kebelakangadalahgerakanbadanberguling

ke arah belakang melalui bagian belakang

badan mulai dari pinggul bagian belakang,

pinggang,punggung,dantengkak.

Dilihatdarikondisiawalselainhasil

persentase dan nilai rata-rata siswa me-

ngalami peningkatan hasil tes keterampilan

siswapadapertemuanketigapada siklus1

diperoleh juga hasil pengamatan dibuat

menggunakan kriteria penilaian supaya

mudah dalam menyimpulkan hasil pe-

ngamatan. berdasarkan hasil tes siklus 1

diperolehnilairata-ratagulingdepansebesar

79,4. Jumlah siswa yang mencapai KKM

sebanyak 25 siswa (83,3%) dan siswa yang

belum mencapai KKM sebanyak 5 siswa

(16,6%). Sedangkan nilai rata-rata guling

belakang sebesar 67,3. Jumlah siswa yang

mencapaiKKMsebanyak12siswa(40%)dan

siswayangbelummencapaiKKMsebanyak18

siswa(60%).Hasilbelajarsenamlantaiguling

depan dan guling belakang menunjukan

masih ada beberapa siswa yang masih

mengalami kesulitan dalam melakukan

gerakansenamlantaigulingdepandanguling

belakangterutamadalammelakukangerakan

berguling kebelakang, karenapada siklus1

siswa belum memenuhi ketercapaian KKM,

yaitu sebesar 70% siswa yang tuntas,maka

penelitiandilanjutkanpadasiklus2.

Peningkatanhasilpembelajaransenam

lantai guling depan dan guling belakang

menggunakanmediavideopadasiswakelas

XI TKJ 4 SMK Negeri 10 Malang, ditandai

denganpeningkatannilairata-ratasiswadan

persentase ketuntasan hasil tes siswa. Nilai

rata-ratagulingdepanpadakondisiawalyaitu

69.5 dan persentase ketuntasan hasil tes

siswasenamlantaigulingdepansiswapada

kondisi awal sebesar 40% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

padasiklus1yaitu79.4dengan persentase

ketuntasan sebesar 83.3% dan siklus 2

mengalami peningkatan nilai rata-rata yaitu

81.9 dengan persentase ketuntasan sebesar

86.6%. Sedangkan, peningkatan juga terjadi

pada nilai rata-rata hasil tes senam lantai

gulingbelakangdengankodisiawalyaitu66.5

dengan persentase 20% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus 1 yaitu 67 dengan persentase

ketuntasan sebesar 40%. Namun, pe-

ningkatan tersebut masih belum mencapai

target yang ditetapkan sebelumnya. Ke-

mudiansetelahmelanjutkankesiklus2nilai

rata-ratasiswamengalamipeningkatanyaitu

76.6dengan persentaseketuntasansebesar

83.3%. Hal tersebut menunjukkan bahwa

target yang telah ditetapkan sebelumnya

sudahtercapaisehinggapenelitiandihentikan

pada siklus 2. Proses pembelajaran senam

lantai guling depan dan guling belakang

menggunakanmediavideopadasiswakelas

XITKJ4SMKNegeri10Malangberlangsung

dinamis dan menyenangkan, serta karakter

siswa dari tanggung jawab, percaya diri,

kompetitif, dan semangat jugameningkat di

setiap pertemuan. Siswa aktif mematuhi

perintah dan mengamati gerakan guling

depandangulingbelakang.Dengandemikian

Page 8: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

8 9

dapatdisimpulkanbahwapenelitianberakhir

padasiklus2.

Darihasilpenelitianterdapat4siswa

(13.3%) yang belum memenuhi batas KKM

ataubelumtuntaspadamaterisenamlantai

guling depan siklus 2 dan terdapat 5 siswa

(16.6%) yang juga belum memenuhi batas

KKM atau belum tuntas padamateri senam

lantai guling belakangpada siklus 2.Hal ini

dikarenakan pada saat pelaksanaan pe-

nelitian siswa tersebut terlihat kurang

maksimaldalammengikutipembelajarandan

mempraktekan gerakan senam lantai guling

depan dan guling belakang pada siklus 2.

Siswa ada yang sedang sakit pada saat

mengikuti pembelajaran, tetapi siswa

tersebuttetapinginmengikutipembelajaran

seperti teman lainnyameskipunguru sudah

mengingatkan untuk boleh tidak mengikuti

pembelajaran.

SIMPULANDANSARAN

Simpulan

Penerapanmediapembelajaranvideo

dapat meningkatkan keterampilan senam

lantaigulingdepandangulingbelakangpada

siswa kelas IX TKJ SMK Negeri 10 Malang

denganpeningkatannilairata-ratasiswadan

persentase ketuntasan hasil tes siswa. Nilai

rata-ratagulingdepanpadakondisiawalyaitu

69.5 dan persentase ketuntasan hasil tes

siswasenamlantaigulingdepansiswapada

kondisi awal sebesar 40% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus I yaitu 79.4 dengan persentase

ketuntasan sebesar 83.3% dan siklus 2

mengalami peningkatan nilai rata-rata yaitu

81.9 dengan persentase ketuntasan sebesar

86.6%. Sedangkan, peningkatan juga terjadi

pada nilai rata-rata hasil tes senam lantai

gulingbelakangdengankodisiawalyaitu66.5

dengan persentase 20% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus I yaitu 67 dengan persentase

ketuntasan sebesar 40%. Namun, pe-

ningkatan tersebut masih belum mencapai

target yang ditetapkan sebelumnya. Ke-

mudiansetelahmelanjutkankesiklus2nilai

rata-ratasiswamengalamipeningkatanyaitu

76.6dengan persentaseketuntasansebesar

83.3%.

Saran

1. Hendaknya SMK Negeri 10 Malang perlu

menyediakan sarana dan prasarana yang

lengkap untukmendukung terlaksananya

kegiatan belajar mengajar yang menye-

nangkan bagi siswa. Sehingga siswa ter-

motivasiuntukselalubelajardanmengem-

bangkankemampuannya.

2. Guru harus lebih mengembangkan

pengetahuannya mengenai kegiatan-

kegiatanpembelajarandalampeningkatan

kemam-puan senam lantai guling depan

dan guling belakang, sehingga dapat

memberikan pem-belajaran yang lebih

bervariasi bagi anak dan tidak membuat

anakbosan.

3. Guru harusmenentukan langkah-langkah

pembelajaran yang akan dilakukan agar

dapat menyampaikan informasi kepada

anakdenganlancardanbenar.

4. Kemandirian, keberanian, dan ketepatan

siswa dalam menyelesaikan masalah

adalah salah satu hal yang perlu di-

perhatikan dalam peningkatan kemam-

puansenamlantaigulingdepandanguling

belakangsiswa.

5. Guru harus senantiasa memberi ke-

sempatan kepada siswa untuk men-

ciptakan ide-idebarudanmemupukrasa

percaya diri anak sehingga anak tidak

hanyamampumeniru,tetapijugamampu

mengembangkanbahkanmenciptakanide.

DAFTARPUSTAKA.

Arsyad, Azhar. 2014. Media Pembelajaran.Jakarta:RajaGra�indoPersada.

Biasworo. 2009. Senam Lantai. Jakarta: PTGramediaWidiasarana.

Muhajir. 2007. Pendidikan Jasmani danKesehatan.Bandung:PTGloraAksaraPratama.

Muhajir. 2014. Pendidikan Jasmani danKesehatan.Bandung:PTGloraAksaraPratama.

R i y a n a , C h e p p y. 2 0 0 7 . P e d om a nPengembangan Media Video. Jakarta:P3AIUPI.

Roji.2007.PendidikanJasmaniOlahragaDanKesehatan. Jakarta: PT Glora AksaraPratama.

Sukiman. 2012. Pengembangan MediaPembelajaran. Yogyakarta: Pedagogia63.

Sulistyorini. 1990. Pengetahuan KesegaranJasmani.Malang:IKIP.

Syarifuddin. 1997. Pendidikan Jasmani danKesehatanI.Jakarta:Grasin

Page 9: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

8 9

dapatdisimpulkanbahwapenelitianberakhir

padasiklus2.

Darihasilpenelitianterdapat4siswa

(13.3%) yang belum memenuhi batas KKM

ataubelumtuntaspadamaterisenamlantai

guling depan siklus 2 dan terdapat 5 siswa

(16.6%) yang juga belum memenuhi batas

KKM atau belum tuntas padamateri senam

lantai guling belakangpada siklus 2.Hal ini

dikarenakan pada saat pelaksanaan pe-

nelitian siswa tersebut terlihat kurang

maksimaldalammengikutipembelajarandan

mempraktekan gerakan senam lantai guling

depan dan guling belakang pada siklus 2.

Siswa ada yang sedang sakit pada saat

mengikuti pembelajaran, tetapi siswa

tersebuttetapinginmengikutipembelajaran

seperti teman lainnyameskipunguru sudah

mengingatkan untuk boleh tidak mengikuti

pembelajaran.

SIMPULANDANSARAN

Simpulan

Penerapanmediapembelajaranvideo

dapat meningkatkan keterampilan senam

lantaigulingdepandangulingbelakangpada

siswa kelas IX TKJ SMK Negeri 10 Malang

denganpeningkatannilairata-ratasiswadan

persentase ketuntasan hasil tes siswa. Nilai

rata-ratagulingdepanpadakondisiawalyaitu

69.5 dan persentase ketuntasan hasil tes

siswasenamlantaigulingdepansiswapada

kondisi awal sebesar 40% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus I yaitu 79.4 dengan persentase

ketuntasan sebesar 83.3% dan siklus 2

mengalami peningkatan nilai rata-rata yaitu

81.9 dengan persentase ketuntasan sebesar

86.6%. Sedangkan, peningkatan juga terjadi

pada nilai rata-rata hasil tes senam lantai

gulingbelakangdengankodisiawalyaitu66.5

dengan persentase 20% kondisi tersebut

mengalamipeningkatannilairata-ratasiswa

pada siklus I yaitu 67 dengan persentase

ketuntasan sebesar 40%. Namun, pe-

ningkatan tersebut masih belum mencapai

target yang ditetapkan sebelumnya. Ke-

mudiansetelahmelanjutkankesiklus2nilai

rata-ratasiswamengalamipeningkatanyaitu

76.6dengan persentaseketuntasansebesar

83.3%.

Saran

1. Hendaknya SMK Negeri 10 Malang perlu

menyediakan sarana dan prasarana yang

lengkap untukmendukung terlaksananya

kegiatan belajar mengajar yang menye-

nangkan bagi siswa. Sehingga siswa ter-

motivasiuntukselalubelajardanmengem-

bangkankemampuannya.

2. Guru harus lebih mengembangkan

pengetahuannya mengenai kegiatan-

kegiatanpembelajarandalampeningkatan

kemam-puan senam lantai guling depan

dan guling belakang, sehingga dapat

memberikan pem-belajaran yang lebih

bervariasi bagi anak dan tidak membuat

anakbosan.

3. Guru harusmenentukan langkah-langkah

pembelajaran yang akan dilakukan agar

dapat menyampaikan informasi kepada

anakdenganlancardanbenar.

4. Kemandirian, keberanian, dan ketepatan

siswa dalam menyelesaikan masalah

adalah salah satu hal yang perlu di-

perhatikan dalam peningkatan kemam-

puansenamlantaigulingdepandanguling

belakangsiswa.

5. Guru harus senantiasa memberi ke-

sempatan kepada siswa untuk men-

ciptakan ide-idebarudanmemupukrasa

percaya diri anak sehingga anak tidak

hanyamampumeniru,tetapijugamampu

mengembangkanbahkanmenciptakanide.

DAFTARPUSTAKA.

Arsyad, Azhar. 2014. Media Pembelajaran.Jakarta:RajaGra�indoPersada.

Biasworo. 2009. Senam Lantai. Jakarta: PTGramediaWidiasarana.

Muhajir. 2007. Pendidikan Jasmani danKesehatan.Bandung:PTGloraAksaraPratama.

Muhajir. 2014. Pendidikan Jasmani danKesehatan.Bandung:PTGloraAksaraPratama.

R i y a n a , C h e p p y. 2 0 0 7 . P e d om a nPengembangan Media Video. Jakarta:P3AIUPI.

Roji.2007.PendidikanJasmaniOlahragaDanKesehatan. Jakarta: PT Glora AksaraPratama.

Sukiman. 2012. Pengembangan MediaPembelajaran. Yogyakarta: Pedagogia63.

Sulistyorini. 1990. Pengetahuan KesegaranJasmani.Malang:IKIP.

Syarifuddin. 1997. Pendidikan Jasmani danKesehatanI.Jakarta:Grasin

Page 10: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

10 11

UPAYAPENINGKATANKEMAMPUANGURUMENYUSUNRENCANAPELAKSANAANPEMBELAJARAN(RPP)KONTEKSTUALPADASEKOLAHBINAANMENGGUNAKANSTRATEGIREADINGGUIDE

SEMESTERGANJILTAHUN2017-2018DIKECAMATANKUNDURBARATKABUPATENKARIMUN

Arban*

Abstrak:PenelitianinidilaksanakandiduaSekolahyaituSDN001,004,006,007,009dan011KundurBaratKabupatenKarimun, Provinsi KepulauanRiau. Tujuan penulisan penelitian tindakan sekolah ini adalahuntukmeningkatkankemampuangurudalammenyusunRPPkontekstualdenganteknikkunjungankelasdiSDNegeri 001, 004, 006, 007, 009 dan 011 Kundur Barat dalammelaksanakan proses pembelajaran.Metode pengumpulan datanya adalah observasi. Metode analisis datanya adalah deskriptif untuk datakuantitatif. Hasil yang diperoleh dari penelitian ini adalah bahwa supervisi individu dengan teknikkunjungankelasdapatmeningkatkankemampuanguru-gurudalammelaksanakanprosespembelajaransesuaiPeraturanMenteriNomor41Tahun2007yanginteraktif,inspiratif,menantang,memotivasipesertadidiksertamampumembangun.IniterbuktidarihasilyangdiperolehpadasiklusImeningkatrata-ratanyamenjadi80,55daridataawaldanpadasiklusIInaikrata-ratanyamenjadi91,10darisiklusI.Kesimpulanyang diperoleh dari penelitian ini adalah supervisi individu dengan teknik kunjungan kelas dapatmeningkatkankemampuanguru-gurudalammelaksanakanprosespembelajaransesuaiPeraturanMenteriNomor 41 Tahun 2007 yang interaktif, inspiratif, menantang, memotivasi peserta didik serta mampumembangun.

KataKunci:RPPKontektual,StrategiReadingGuide

PENDAHULUAN

Dalam pelaksanaan supervisi yang

dilaksanakanolehpengawaspenelitikepada

guru-guru di SD Negeri Kecamatan Kundur

Baratsudahberjalanbaik.Akantetapimasih

ada beberapa yang harus diperhatikan,

terutama dalam pembuatan RPP masih ada

guruyangmelaksanakanPBM(ProsesBelajar

Mengajar) tidak sesuai dengan RPP yang

dibuatnya. Dari sepuluh sekolah binaan di

KecamatanKundurBarat diSDNegeri,guru-

gurunya masih banyak yang belum me-

lengkapi perangkat pembelajaran ketika

menyampaikan materi dikelas dan tidak

menggunakanalatperagayangsesuai.

Semua guru harus menyusun peren-

canaanpembelajaranatauRPPyaknisebagai

salah satu jenis kegiatan dalam bidang

akademik. Perencanaan pembelajaran yang

disusunolehguruperludiperhatikanbahkan

dilakukanpenilaianolehpengawasdankepala

sekolahmelaluikegiatansupervisi.Berkenaan

dengan hal itu khusus sekolah binaan di

Kecamatan Kundur Barat sangat perlu

mendapatbimbingandaripengawas.

Pelaksanaan supervisi ini di mulai

tanggal2s.d.17Maret 2017semestergenap

tahun pelajaran 2015-2017, pengawas

peneliti telah melakukan penilaian peren-

canaan pembelajaran berorientasi pada

pembelajarankontekstualuntuksemuaguru

dalam wilayah binaan. Perolehan dari hasil

penilaianadabeberapaSDyangmasihbelum

memuaskan. Walaupun dari data tersebut

terdapat guru yang sudah baik dalam

menyusunperencanaanpembelajaran.

Dalam pelaksanaan supervisi ketika

dilakukan wawancara dengan guru tentang

hal tersebut belum bisa menjelaskan

perencanaan pembelajaran kontekstual.

Tentunya hal itu diikuti dengan kurang

memahaminyadalammenyusunperencanaan

pembelajarankontekstual.

BerdasarkanhasilpenilaianRPPmelalui

kegiatan supervisi akademik perencanaan

pembelajarandiatasterdapatcatatansebagai

data empirik penyusunan RPP kontekstual

utamanyapada enamorangdari tiga satuan

pendidikan binaan SD Negeri Kecamatan

Kundur Barat di Kecamatan Kundur Barat.

Untuk menindak lanjuti hal tersebut diatas

pengawas harus menyusun perencanaan

supervisi akademik yang lebih efektif dan

mampu memacu guru untuk meningkatkan

kemampuannya. Perencanaan ini sangat

pentingkarenadidalamnyadisusunskenario

supervisi yang efektif dan mudah di-

laksanakan.

Data dimaksud dapat ditunjukkan pada

hasil penilaianpenyusunanRPPkontekstual

masing-masinggurumemperolehskor50,52,

50.73,50,14,48.66,dan55.Secarakualitatif

masing-masing masuk pada katagori cukup

baik.Namundemikiankondisiinidiupayakan

dapatditingkatkanmenjadilebihbaiklagi.

Memperhatikan data empirik untuk

sejumlah guru tersebut lebih lanjut perlu

ditingkatkan kemampuannya dalam me-

nyusun RPP kontekstual. Upaya untuk itu

dilakukan melalui penelitian tindakan mata

pelajaran.

Upaya pengawas untuk meningkatkan

pemahaman dan penyusunan perencanaan

pembelajaran kontekstual melakukan bim-

bingan melalui penelitian tindakan sekolah.

Bimbingan yang dilakukan oleh pengawas

menggunakanmetodediskusikelompokkecil

dan tugas mandiri. Dengan penggunaan

metode diskusi kelompok, guru bisa aktif

mengungkapkan semua potensi yang

dimilikinyadalamperencanaanpembelajaran

kontekstual.Lebihlanjutmerekadiberitugas

mandiri agar memiliki kemampuan untuk

mengembangkansecaramandiri sebabpada

saat tertentu mereka dituntut harus bisa

menyelesikan tugas profesinya secara

mandiri.

Memperhatikan latar belakangmasalah

yangtelahdiuraikandiatasdapatdirumuskan

masalah : 1) Bagaimana pelaksanaan

peningkatan kemampuan guru menyusun

RPP kontekstual pada sekolah binaan

menggunakanstrategireadingguidesemester

ganjiltahun2017/2018diKecamatanKundur

Barat;2)Apakahpenggunaanstrategireading

guidedapatmeningkatkankemampuanguru

menyusun RPP kontekstual pada sekolah

binaan semester ganjil tahun 2017/2018 di

KecamatanKundurBarat.

Tujuanpenelitianadalahsebagaiberikut:

1) Ingin mengetahui pelaksanaan pe-

ningkatan kemampuan gurumenyusun RPP

kontekstual pada sekolah binaan meng-

gunakan strategi reading guide semester

ganjiltahun2017/2018diKecamatanKundur

Barat; 2) Ingin mengetahui penggunaan

strategi reading guide dapat meningkatkan

kemampuangurumenyusunRPPkontekstual

pada sekolah binaan semester ganjil tahun

2017/2018diKecamatanKundur.

Pencapaian tujuan penelitian tindakan

sekolah melalui proses yang telah di-

laksanakan diharapkan dapat memberikan

manfaatkepadaguru,Pengawaspenelitidan

pengembanganpenelitian,sebagaiberikut:1)

BagiGuru,a)Pengalamangurusebagaisubyek

penelitian melalui proses yang ada di-

harapkan dapat dijadikan pengalaman

empiris untuk pengembangan diri dan pro-

fesinya secara berkelanjutan, b) Menambah

pengetahuan guru untuk melengkapi dan

menggunakan perangkat pembelajaran: 2)

Bagi Pengawas peneliti: a) Pengembangan

profesi sebagai seorang pengawas melalui

penelitian tindakan menjadikan hal ke-

harusan dalam upaya untuk meningkatkan

manajemen dan sumber daya pada wilayah

Page 11: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

10 11

UPAYAPENINGKATANKEMAMPUANGURUMENYUSUNRENCANAPELAKSANAANPEMBELAJARAN(RPP)KONTEKSTUALPADASEKOLAHBINAANMENGGUNAKANSTRATEGIREADINGGUIDE

SEMESTERGANJILTAHUN2017-2018DIKECAMATANKUNDURBARATKABUPATENKARIMUN

Arban*

Abstrak:PenelitianinidilaksanakandiduaSekolahyaituSDN001,004,006,007,009dan011KundurBaratKabupatenKarimun, Provinsi KepulauanRiau. Tujuan penulisan penelitian tindakan sekolah ini adalahuntukmeningkatkankemampuangurudalammenyusunRPPkontekstualdenganteknikkunjungankelasdiSDNegeri 001, 004, 006, 007, 009 dan 011 Kundur Barat dalammelaksanakan proses pembelajaran.Metode pengumpulan datanya adalah observasi. Metode analisis datanya adalah deskriptif untuk datakuantitatif. Hasil yang diperoleh dari penelitian ini adalah bahwa supervisi individu dengan teknikkunjungankelasdapatmeningkatkankemampuanguru-gurudalammelaksanakanprosespembelajaransesuaiPeraturanMenteriNomor41Tahun2007yanginteraktif,inspiratif,menantang,memotivasipesertadidiksertamampumembangun.IniterbuktidarihasilyangdiperolehpadasiklusImeningkatrata-ratanyamenjadi80,55daridataawaldanpadasiklusIInaikrata-ratanyamenjadi91,10darisiklusI.Kesimpulanyang diperoleh dari penelitian ini adalah supervisi individu dengan teknik kunjungan kelas dapatmeningkatkankemampuanguru-gurudalammelaksanakanprosespembelajaransesuaiPeraturanMenteriNomor 41 Tahun 2007 yang interaktif, inspiratif, menantang, memotivasi peserta didik serta mampumembangun.

KataKunci:RPPKontektual,StrategiReadingGuide

PENDAHULUAN

Dalam pelaksanaan supervisi yang

dilaksanakanolehpengawaspenelitikepada

guru-guru di SD Negeri Kecamatan Kundur

Baratsudahberjalanbaik.Akantetapimasih

ada beberapa yang harus diperhatikan,

terutama dalam pembuatan RPP masih ada

guruyangmelaksanakanPBM(ProsesBelajar

Mengajar) tidak sesuai dengan RPP yang

dibuatnya. Dari sepuluh sekolah binaan di

KecamatanKundurBarat diSDNegeri,guru-

gurunya masih banyak yang belum me-

lengkapi perangkat pembelajaran ketika

menyampaikan materi dikelas dan tidak

menggunakanalatperagayangsesuai.

Semua guru harus menyusun peren-

canaanpembelajaranatauRPPyaknisebagai

salah satu jenis kegiatan dalam bidang

akademik. Perencanaan pembelajaran yang

disusunolehguruperludiperhatikanbahkan

dilakukanpenilaianolehpengawasdankepala

sekolahmelaluikegiatansupervisi.Berkenaan

dengan hal itu khusus sekolah binaan di

Kecamatan Kundur Barat sangat perlu

mendapatbimbingandaripengawas.

Pelaksanaan supervisi ini di mulai

tanggal2s.d.17Maret 2017semestergenap

tahun pelajaran 2015-2017, pengawas

peneliti telah melakukan penilaian peren-

canaan pembelajaran berorientasi pada

pembelajarankontekstualuntuksemuaguru

dalam wilayah binaan. Perolehan dari hasil

penilaianadabeberapaSDyangmasihbelum

memuaskan. Walaupun dari data tersebut

terdapat guru yang sudah baik dalam

menyusunperencanaanpembelajaran.

Dalam pelaksanaan supervisi ketika

dilakukan wawancara dengan guru tentang

hal tersebut belum bisa menjelaskan

perencanaan pembelajaran kontekstual.

Tentunya hal itu diikuti dengan kurang

memahaminyadalammenyusunperencanaan

pembelajarankontekstual.

BerdasarkanhasilpenilaianRPPmelalui

kegiatan supervisi akademik perencanaan

pembelajarandiatasterdapatcatatansebagai

data empirik penyusunan RPP kontekstual

utamanyapada enamorangdari tiga satuan

pendidikan binaan SD Negeri Kecamatan

Kundur Barat di Kecamatan Kundur Barat.

Untuk menindak lanjuti hal tersebut diatas

pengawas harus menyusun perencanaan

supervisi akademik yang lebih efektif dan

mampu memacu guru untuk meningkatkan

kemampuannya. Perencanaan ini sangat

pentingkarenadidalamnyadisusunskenario

supervisi yang efektif dan mudah di-

laksanakan.

Data dimaksud dapat ditunjukkan pada

hasil penilaianpenyusunanRPPkontekstual

masing-masinggurumemperolehskor50,52,

50.73,50,14,48.66,dan55.Secarakualitatif

masing-masing masuk pada katagori cukup

baik.Namundemikiankondisiinidiupayakan

dapatditingkatkanmenjadilebihbaiklagi.

Memperhatikan data empirik untuk

sejumlah guru tersebut lebih lanjut perlu

ditingkatkan kemampuannya dalam me-

nyusun RPP kontekstual. Upaya untuk itu

dilakukan melalui penelitian tindakan mata

pelajaran.

Upaya pengawas untuk meningkatkan

pemahaman dan penyusunan perencanaan

pembelajaran kontekstual melakukan bim-

bingan melalui penelitian tindakan sekolah.

Bimbingan yang dilakukan oleh pengawas

menggunakanmetodediskusikelompokkecil

dan tugas mandiri. Dengan penggunaan

metode diskusi kelompok, guru bisa aktif

mengungkapkan semua potensi yang

dimilikinyadalamperencanaanpembelajaran

kontekstual.Lebihlanjutmerekadiberitugas

mandiri agar memiliki kemampuan untuk

mengembangkansecaramandiri sebabpada

saat tertentu mereka dituntut harus bisa

menyelesikan tugas profesinya secara

mandiri.

Memperhatikan latar belakangmasalah

yangtelahdiuraikandiatasdapatdirumuskan

masalah : 1) Bagaimana pelaksanaan

peningkatan kemampuan guru menyusun

RPP kontekstual pada sekolah binaan

menggunakanstrategireadingguidesemester

ganjiltahun2017/2018diKecamatanKundur

Barat;2)Apakahpenggunaanstrategireading

guidedapatmeningkatkankemampuanguru

menyusun RPP kontekstual pada sekolah

binaan semester ganjil tahun 2017/2018 di

KecamatanKundurBarat.

Tujuanpenelitianadalahsebagaiberikut:

1) Ingin mengetahui pelaksanaan pe-

ningkatan kemampuan gurumenyusun RPP

kontekstual pada sekolah binaan meng-

gunakan strategi reading guide semester

ganjiltahun2017/2018diKecamatanKundur

Barat; 2) Ingin mengetahui penggunaan

strategi reading guide dapat meningkatkan

kemampuangurumenyusunRPPkontekstual

pada sekolah binaan semester ganjil tahun

2017/2018diKecamatanKundur.

Pencapaian tujuan penelitian tindakan

sekolah melalui proses yang telah di-

laksanakan diharapkan dapat memberikan

manfaatkepadaguru,Pengawaspenelitidan

pengembanganpenelitian,sebagaiberikut:1)

BagiGuru,a)Pengalamangurusebagaisubyek

penelitian melalui proses yang ada di-

harapkan dapat dijadikan pengalaman

empiris untuk pengembangan diri dan pro-

fesinya secara berkelanjutan, b) Menambah

pengetahuan guru untuk melengkapi dan

menggunakan perangkat pembelajaran: 2)

Bagi Pengawas peneliti: a) Pengembangan

profesi sebagai seorang pengawas melalui

penelitian tindakan menjadikan hal ke-

harusan dalam upaya untuk meningkatkan

manajemen dan sumber daya pada wilayah

Page 12: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

12 13

binaan khususnya tenaga pendidik dalam

menyusunRPP,b)MengetahuiMatapelajaran

yangperluditindaklanjutidalammelengkapi

danpenggunakanperangkatpembelajaran.

PemahamanKemampuan

PemahamanmenurutSadimanadalah

suatu kemampuan sesorang dalam me-

ngartikan,menafsirkan,menerjemahkan,atau

menyatakan sesuatudengan caranya sendiri

tentang pengetahuan yang pernah di-

terimanya. Sedangkan menurut kamus

lengkapbahasaIndonesiapemahamanadalah

sesuatu hal yang kita pahami dan kita

mengerti dan benar. Suharsimi menyatakan

bahwa pemahaman (comprehension) adalah

bagaimana sesorang mempertahankan,

membedakan, menduga (estimates), me-

nerangkan, memperluas, menyimpulkan,

menggeneralisasikan, memberikan contoh,

menuliskan kembali, dan memperkirakan.

Dengan pemahaman, siswa diminta untuk

membuktikanbahwaiamemahamihubungan

yang sederhana di antara fakta-fakta atau

konsep. (http://www.duniapelajar.com/

2011/09/02/defenisi-pemahaman-menurut-

para-ahli/)

StrategiReadingGuide

Reading Guide (Panduan Membaca)

merupakan strategi pembelajaran atau

pembimbingan yang mampu mengakti�kan

siswa untuk belajar atau orang yang

mendapatkan bimbingan untuk me-

nyelesaikan sebuah pekerjaan. Hal ini

sebagaimanadikemukakanolehHisyamZaini

(2008:8)yangmengemukakanbahwa,dalam

beberapa kesempatan, sering terdapat

kejadianbahwamateridapatdiselesaikandi

dalam kelas dan harus diselesaikan di luar

kelas karena banyaknya materi yang harus

diselesaikan.Dalamkeadaansepertiinidapat

digunakansecaraoptimal.

Memahami pendapat tersebut bahwa

strategiReadingGuidebagaisiswaatauorang

yang dibimbing dalam menyelesaikan tugas

yang telahdiberikandapatdilakukan secara

individu atau mata pelajaran dan bisa

dikerjakan di dalam ruangan atau di luar

ruangan belajar/bimbingan. Untuk kegiatan

bimbingan dalam penelitian ini, untuk

menyelesaikan tugas menggunakan dua

teknikyaitu tugasmatapelajarankecil dan

individu.

Lebih lanjut Hisyam Zaini merumuskan

langkah-langkah penerapan strategiReading

Guide yang pada intinya, sebagai berikut: 1)

Tentukanbacaanyangakandipelajari,2)Buat

pertanyaan-pertanyaan yang akan dijawab

olehsiswaataupesertabimbingan,3)Berikan

tambahan bacaan selain bacaan (portofolio)

yangtelahdisediakanolehsiswaataupeserta

bimbingan, 4) Berikan tugas kepada siswa

ataupesertabimbingansesuaideganmateri

yangdiberikandenganmenggunakanmedia

portofolio sebagai panduan/penuntun atau

referensibacaan(ReadingGuide),5)Berikan

waktu untuk melakukan diskusi atau tugas

individu hingga menyelesaikan tugasnya

dengan baik, 6) Berikan waktu untuk

presentasidanlanjutkandengankon�irmasi.

TeknikpelaksanaanstrategiReadingGuide

Untuk mengajak para guru agar

mampu mencurahkan atau mengungkapkan

semua potensi yang dimiliki tentang RPP

kontekstualmakadalampelaksanaanstrategi

reading guide menggunakan diskusi mata

pelajaran. Didalam kegiatan diskusi antar

anggotamatapelajaranakanterjadiinteraksi

aktifdanfokuspadamasalahyangdiberikan

oleh pengawas peneliti. Sehingga proses

diskusi yang dialami guru menjadi terarah

sesuai dengan yang diharapkan oleh pe-

ngawaspeneliti.

Hal ini sebagaimana dikemukakan

Soekartawi, dkk. (1995:66) mengemukakan

bahwa metode diskusi merupakan interaksi

antara mahasiswa dengan mahasiswa atau

mahasiswa dengan pengajar untuk meng-

analisis, mengenali atau memperdebatkan

topikataupermasalahantertentu.

Abu Syamsudin Makmum (2001)

mengemukakan bahwa metode diskusi

merupakancaralaindalambelajarmengajar

dimanagurudansiswa,antarasiswaterlibat

adalah dalam suatu proses interaksi secara

aktif dan timbal balik dari dua arah (two or

multiways of comunication) baik dalam

perumusanmasalah,penyampaianinformasi,

pembahasan maupun dalam pengambilan

keputusan.

Pemberiantugasindividu

Pemberian tugas individu kepada

seseorang untuk menyelesaikan tugas yang

harusdiselesaikanmerupakankegiatanyang

sangatpentingsebabpadasaat-saattertentu

seseorangituakandihadapkansecaramandiri

untuk menyelesaikan sebuah masalah yang

sedangdihadapidemikianhalnyadenganpara

guruyangdalambimbinganpadasaattertentu

akan melaksanakan tugas-tugas profesinya

secaramandiri.

Menurut Dimyati, dkk (1998;114)

bahwa setiap proses pembelajaran pasti

menampakkan keaktifan seseorang yang

belajaratausiswa.Pernyataaninitidakdapat

dibantahataukitatolakkebenarannya.Lebih

lanjut ia menjelaskan bahwa kegiatan �isik

yangdapatdiamatidiantaranyadalambentuk

kegiatan membaca, mendengarkan, menulis,

meragakan danmengatur. Sedangkan secara

psikis sepertimengingatkembali isimateri

pelajaran pertemuan sebelumnya, meng-

gunakankhasanahpengetahuanyangdimiliki

dalam memecahkan suatu konsep yang

dihadapi, menyimpulkan hasil eksperimen,

membandingkansatukonsepdengankonsep

yanglaindankegiatanpsikislainnya.

Tugas individu dalam proses bim-

bingan diberikan pada tahap kedua sebagai

kelanjutandaritahapanpertamadalamupaya

melihat perkembangan kemampuan guru

dalam menyusun RPP kontekstual. Dalam

pelaksanaannya guru tetap diberikan

kesempatan untuk memanfaakan referensi

RPPkontekstualsebagaibentukpelaksanaan

strategireadingguide.

PembelajaranKontekstual

Pembelajaran kontekstual merupakan

salah satu pendekatan pembelajaran yang

mengajak siswa atau orang yang dibimbing

masuk kedunia nyata yang terkait langsung

dengan materi pembelajaran atau pem-

bimbinganyangdiberikan.DalamKurikulum

Tingkat Satuan Pendidikan (KTSP) mem-

berikan sinyal dalam implementasinya

menggunakan strategi dengan menekankan

pada aspek kinerja siswa (Contextual

TeachingandLearning).Dalamhalinifungsi

danperanguruhanyasebagaimediatorsiswa

lebih proaktif untuk merumuskan sendiri

tentangfenomenayangberaitandenganfokus

kajian secara kontekstual bukan tekstual

(Trianto,2008).

Pembelajarankontekstualterjadiapabila

siswamenerapkandanmengalamiapayang

sedang diajarkan dengan mengacu pada

masalah-masalah dunia nyata yang ber-

hubungandenganperandantanggungjawab

meraka sebagai anggota keluarga, warga

negara,siswadantenagakerja(Universityof

Page 13: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

12 13

binaan khususnya tenaga pendidik dalam

menyusunRPP,b)MengetahuiMatapelajaran

yangperluditindaklanjutidalammelengkapi

danpenggunakanperangkatpembelajaran.

PemahamanKemampuan

PemahamanmenurutSadimanadalah

suatu kemampuan sesorang dalam me-

ngartikan,menafsirkan,menerjemahkan,atau

menyatakan sesuatudengan caranya sendiri

tentang pengetahuan yang pernah di-

terimanya. Sedangkan menurut kamus

lengkapbahasaIndonesiapemahamanadalah

sesuatu hal yang kita pahami dan kita

mengerti dan benar. Suharsimi menyatakan

bahwa pemahaman (comprehension) adalah

bagaimana sesorang mempertahankan,

membedakan, menduga (estimates), me-

nerangkan, memperluas, menyimpulkan,

menggeneralisasikan, memberikan contoh,

menuliskan kembali, dan memperkirakan.

Dengan pemahaman, siswa diminta untuk

membuktikanbahwaiamemahamihubungan

yang sederhana di antara fakta-fakta atau

konsep. (http://www.duniapelajar.com/

2011/09/02/defenisi-pemahaman-menurut-

para-ahli/)

StrategiReadingGuide

Reading Guide (Panduan Membaca)

merupakan strategi pembelajaran atau

pembimbingan yang mampu mengakti�kan

siswa untuk belajar atau orang yang

mendapatkan bimbingan untuk me-

nyelesaikan sebuah pekerjaan. Hal ini

sebagaimanadikemukakanolehHisyamZaini

(2008:8)yangmengemukakanbahwa,dalam

beberapa kesempatan, sering terdapat

kejadianbahwamateridapatdiselesaikandi

dalam kelas dan harus diselesaikan di luar

kelas karena banyaknya materi yang harus

diselesaikan.Dalamkeadaansepertiinidapat

digunakansecaraoptimal.

Memahami pendapat tersebut bahwa

strategiReadingGuidebagaisiswaatauorang

yang dibimbing dalam menyelesaikan tugas

yang telahdiberikandapatdilakukan secara

individu atau mata pelajaran dan bisa

dikerjakan di dalam ruangan atau di luar

ruangan belajar/bimbingan. Untuk kegiatan

bimbingan dalam penelitian ini, untuk

menyelesaikan tugas menggunakan dua

teknikyaitu tugasmatapelajarankecil dan

individu.

Lebih lanjut Hisyam Zaini merumuskan

langkah-langkah penerapan strategiReading

Guide yang pada intinya, sebagai berikut: 1)

Tentukanbacaanyangakandipelajari,2)Buat

pertanyaan-pertanyaan yang akan dijawab

olehsiswaataupesertabimbingan,3)Berikan

tambahan bacaan selain bacaan (portofolio)

yangtelahdisediakanolehsiswaataupeserta

bimbingan, 4) Berikan tugas kepada siswa

ataupesertabimbingansesuaideganmateri

yangdiberikandenganmenggunakanmedia

portofolio sebagai panduan/penuntun atau

referensibacaan(ReadingGuide),5)Berikan

waktu untuk melakukan diskusi atau tugas

individu hingga menyelesaikan tugasnya

dengan baik, 6) Berikan waktu untuk

presentasidanlanjutkandengankon�irmasi.

TeknikpelaksanaanstrategiReadingGuide

Untuk mengajak para guru agar

mampu mencurahkan atau mengungkapkan

semua potensi yang dimiliki tentang RPP

kontekstualmakadalampelaksanaanstrategi

reading guide menggunakan diskusi mata

pelajaran. Didalam kegiatan diskusi antar

anggotamatapelajaranakanterjadiinteraksi

aktifdanfokuspadamasalahyangdiberikan

oleh pengawas peneliti. Sehingga proses

diskusi yang dialami guru menjadi terarah

sesuai dengan yang diharapkan oleh pe-

ngawaspeneliti.

Hal ini sebagaimana dikemukakan

Soekartawi, dkk. (1995:66) mengemukakan

bahwa metode diskusi merupakan interaksi

antara mahasiswa dengan mahasiswa atau

mahasiswa dengan pengajar untuk meng-

analisis, mengenali atau memperdebatkan

topikataupermasalahantertentu.

Abu Syamsudin Makmum (2001)

mengemukakan bahwa metode diskusi

merupakancaralaindalambelajarmengajar

dimanagurudansiswa,antarasiswaterlibat

adalah dalam suatu proses interaksi secara

aktif dan timbal balik dari dua arah (two or

multiways of comunication) baik dalam

perumusanmasalah,penyampaianinformasi,

pembahasan maupun dalam pengambilan

keputusan.

Pemberiantugasindividu

Pemberian tugas individu kepada

seseorang untuk menyelesaikan tugas yang

harusdiselesaikanmerupakankegiatanyang

sangatpentingsebabpadasaat-saattertentu

seseorangituakandihadapkansecaramandiri

untuk menyelesaikan sebuah masalah yang

sedangdihadapidemikianhalnyadenganpara

guruyangdalambimbinganpadasaattertentu

akan melaksanakan tugas-tugas profesinya

secaramandiri.

Menurut Dimyati, dkk (1998;114)

bahwa setiap proses pembelajaran pasti

menampakkan keaktifan seseorang yang

belajaratausiswa.Pernyataaninitidakdapat

dibantahataukitatolakkebenarannya.Lebih

lanjut ia menjelaskan bahwa kegiatan �isik

yangdapatdiamatidiantaranyadalambentuk

kegiatan membaca, mendengarkan, menulis,

meragakan danmengatur. Sedangkan secara

psikis sepertimengingatkembali isimateri

pelajaran pertemuan sebelumnya, meng-

gunakankhasanahpengetahuanyangdimiliki

dalam memecahkan suatu konsep yang

dihadapi, menyimpulkan hasil eksperimen,

membandingkansatukonsepdengankonsep

yanglaindankegiatanpsikislainnya.

Tugas individu dalam proses bim-

bingan diberikan pada tahap kedua sebagai

kelanjutandaritahapanpertamadalamupaya

melihat perkembangan kemampuan guru

dalam menyusun RPP kontekstual. Dalam

pelaksanaannya guru tetap diberikan

kesempatan untuk memanfaakan referensi

RPPkontekstualsebagaibentukpelaksanaan

strategireadingguide.

PembelajaranKontekstual

Pembelajaran kontekstual merupakan

salah satu pendekatan pembelajaran yang

mengajak siswa atau orang yang dibimbing

masuk kedunia nyata yang terkait langsung

dengan materi pembelajaran atau pem-

bimbinganyangdiberikan.DalamKurikulum

Tingkat Satuan Pendidikan (KTSP) mem-

berikan sinyal dalam implementasinya

menggunakan strategi dengan menekankan

pada aspek kinerja siswa (Contextual

TeachingandLearning).Dalamhalinifungsi

danperanguruhanyasebagaimediatorsiswa

lebih proaktif untuk merumuskan sendiri

tentangfenomenayangberaitandenganfokus

kajian secara kontekstual bukan tekstual

(Trianto,2008).

Pembelajarankontekstualterjadiapabila

siswamenerapkandanmengalamiapayang

sedang diajarkan dengan mengacu pada

masalah-masalah dunia nyata yang ber-

hubungandenganperandantanggungjawab

meraka sebagai anggota keluarga, warga

negara,siswadantenagakerja(Universityof

Page 14: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

14 15

Washington,2001).Pembelajarankonteksual

adalah pembelajaran yang terjadi dalam

hubungan yang erat dengan pengalaman

sesungguhnya(Blanchard,2001).

Merujuk pendapat di atas maka dapat

disimpulkan bahwa pendekatan pem-

belajarankontekstualmerupakanpendekatan

pembelajaranyangmenempatkanatauorang

yangdibimbinguntukbisamenerapkandan

mengalami apa yang sedangditerimadalam

bentuk materi pembelajaran yang terkait

langsung dengan kondisi nyata dalam

lingkungan kehidupan sehari-hari. Baik itu

bersifat pengetahuan nilai-nilai, tanggung

jawabsebagaipribadi,anggotakeluargaatau

sebagai warga bangsa. Dalam kontes

penyusunanRPPkontekstualguruharusbisa

merangkai kegiatan pembelajaran dalam

sekenarionya yang mengkaitkan materi

dengan kondisi nyata dalam kondisi

kehidupansehari-hari.

Vernon A. Magnesen mengemukakan

tentangcarabelajardancaraberpikirbahwa

90%dariapayangkitakatakandanlakukan

memudahkan cara otak bekerja, memori

bekerja, cara kita menyimpan informasi,

mengambilnya, menghubungkannya dengan

konsep lain,danmencaripengetahuanbaru,

kapanpunandamemerlukannyadengancepat

(dalam Gordon Dryden & Jeannette Vos,

2003).

Memperhatikan pendapat tersebut dan

agar pelaksanaan pembelajaran di kelas

mencerminkan pembe la j a ran ak t i f

kontekstual maka RPP yang disusun harus

berorientasikontekstual.

Pembelajaran CTL (Contextual

Teaching and Learning)

Pembelajarankontekstualmerupakan

salah satu pendekatan pembelajaran yang

menekankan pentingnya menghadirkan

lingkungan alamiah dalam proses pem-

belajaran agar siswa dalam proses pem-

belajaranmampumengembangkan diri dari

materi yang diterima dengan kondisi nyata

yangadadilingkungan.

Terdapat lima hal yang perlu di-

perhatikan bagi guru dalam penerapan

pembelajaran kontekstual yang disingkat

REACT (Nurhadi, 2006:23) yaitu sebagai

berikut:1.Relating.Belajardikaitkandengan

kehidupan nyata siswa, 2) Experiencting.

Belajar ditekankan pada penggalian atau

eksplorasi, penemuan atau diskoveri, dan

penciptan (inventional),3) Apllying.Belajar

bagaimana pengetahuan dipresentasikan

dalam konteks pemanfaatannya, 4) Coo-

perating.Belajarmelaluikontekskomunikasi

interpersonal pemahaman bersama dan

sebagainya, 5) Transfering, Belajar melalui

pemanfaatan pengetahuan di dalam situasi

ataukonteksbaru.

Selanjutnya Nurhadi (2006:33-34)

mengemukakan bahwa CTL (Contextual

Teaching and Learning) adalah salah satu

model pembelajaran yang menggunakan

pendekatan kontekstual. Pandangan CTL

(Contextual Teaching and Learning) tentang

belajaradalahsebagaiberikut:a)Belajartidak

hanyasekedarmenghafal,siswaharusdapat

mengkonstruksi sendiri pengetahuannya, b)

Anakbelajardaripengalaman,anakmencatat

sendiripolabermaknadaripengetahuanbaru

dantidakbegitusajamenerimapengetahuan

dariguru,c)Pengetahuantidakbisadipisah-

pisahmenjadifakta-faktaatauproporsiyang

terpisah, tapi mencerminkan keterampilan

yang diterapkan, d) Siswa perlu dibiasakan

memecahkan masalah menentukan sesuatu

yang berguna bagi dirinya sendiri dan

bergelut dengan ide-ide, c) Proses belajar

dapat mengubah struktur otak. Dalam

kontekspembelajarandalampendekatan ini

anak harus tahu makna belajar dan

bagaimana menggunakan pengetahuan dan

keterampilanyangdiperolehnyaolehkarena

itu transfer belajar diupayakan siswa

menjalanisendiri.

Berikutnya Nurhadi (2006:42-52)

menjelaskan bahwa penerapan pendekatan

kontekstualdikelas(ContextualTeachingand

Learning) sesuai dengan karakteristiknya

memiliki tujuh komponen yaitu kon-

strukstivisme (Construktivism), Inkuiri

(Inquiry),bertanya(Questioning),Masyarakat

belajar (Learning Comunity), Pemodelan

(Modeling),Re�kesi(Re�lection)danPenilaian

sebenarnya(AutenticAssesment).

KerangkaKonseptual

Agar penelitian dapat berlangsung

denganbaikdanmemberikankejelasanbaik

pada aspek berpikir maupun perilaku

penelitian maka perlu kerangka konseptual

yang mudah dipahami dan dilaksanakan

sesuai dengan tahapan-tahapan atau siklus

yang ditetapkan: 1) Kondisi Awal. Kondisi

awal merupakan kemampuan awal guru

dalam menyusun RPP kontekstual. Untuk

mendapatkan data awal para guru diminta

arsip RPP yang menurut mereka sudah

Kontekstual dan dipergunakan dalam

kegiatan pembelajaran; 2) Pemberian

Tindakan. Untuk peningkatan kemampuan

guru dalam menyusun RPP kontekstual

menggunakan tahapan (siklus) sebagai

berikut: a) Pada siklus pertama, guru

menyusun RPP kontekstual melalui diskusi

Matapelajarankecildenganmemperhatikan

hasilkerjaberupaRPPyangmenurutmereka

adalah Kontekstual. Hasil kerja (produk)

masing-masing guru tersebut dibahas

kembali dalam kelompok dan melalui

pembahasantersebutdiharapkansetiapguru

dapat menghasilkan produk baru. Produk

baru dapat berupa hasil review atau hasil

pegembangan produk yang lama, b) Pada

sikluskeduagurumenyusunRPPkontekstual

melaluitugasindividudenganharapandapat

menghasilkan produk RPP kontekstual yang

baik dan sesuai dengan yang diharapkan, c)

KondisiAkhir.Setelah diupayakan tindakan

melalui strategi Reading Guide baik secara

diskusikecildalamkelompokmaupunmelalui

tugas individu hasilnya dapat dibuktikan

bahwa strategi Reading Guide dapat

meningkatkanHasilkerjagurumenyusunRPP

kontekstualsesuaidenganyangdiharapkan.

Untuk lebih jelasnya kerangka ber�ikir

penelitian tindakan Mata pelajaran (PTS)

sebagaiberikut:

KONDISI AWAL

TINDAKAN

Penyusunan RPP

Kontekstual

melalui

strategi Reading Guide

Kondisi Akhir

Diduga bimbingan

menggunakan strategi

Reading Guide guru dapat

menyusunan RPP

Refleksi

Refleksi

SIKLUS I

Menyusun RPP

Kontekstual

teknik diskusi

Diperoleh

kemampuan

awal guru

menyusun RPP

SIKLUS II

Menyusun RPP

Kontekstual

dengan teknik

METODOLOGIPENELITIAN

SubyekPenelitian

Subyek penelitian diambil dari

sejumlah populasi yang ada sebanyak 100

guru dari 10 sekolah binaan. SD negeri di

Kecamatan Kundur . Mata pelajaran yang

diajarkanyaituTematik.Pengambilansubyek

penelitiandiantaranyadenganpertimbangan

bentuk penelitian yang digunakan adalah

penelitian tindakan. Selain itu merujuk

Page 15: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

14 15

Washington,2001).Pembelajarankonteksual

adalah pembelajaran yang terjadi dalam

hubungan yang erat dengan pengalaman

sesungguhnya(Blanchard,2001).

Merujuk pendapat di atas maka dapat

disimpulkan bahwa pendekatan pem-

belajarankontekstualmerupakanpendekatan

pembelajaranyangmenempatkanatauorang

yangdibimbinguntukbisamenerapkandan

mengalami apa yang sedangditerimadalam

bentuk materi pembelajaran yang terkait

langsung dengan kondisi nyata dalam

lingkungan kehidupan sehari-hari. Baik itu

bersifat pengetahuan nilai-nilai, tanggung

jawabsebagaipribadi,anggotakeluargaatau

sebagai warga bangsa. Dalam kontes

penyusunanRPPkontekstualguruharusbisa

merangkai kegiatan pembelajaran dalam

sekenarionya yang mengkaitkan materi

dengan kondisi nyata dalam kondisi

kehidupansehari-hari.

Vernon A. Magnesen mengemukakan

tentangcarabelajardancaraberpikirbahwa

90%dariapayangkitakatakandanlakukan

memudahkan cara otak bekerja, memori

bekerja, cara kita menyimpan informasi,

mengambilnya, menghubungkannya dengan

konsep lain,danmencaripengetahuanbaru,

kapanpunandamemerlukannyadengancepat

(dalam Gordon Dryden & Jeannette Vos,

2003).

Memperhatikan pendapat tersebut dan

agar pelaksanaan pembelajaran di kelas

mencerminkan pembe la j a ran ak t i f

kontekstual maka RPP yang disusun harus

berorientasikontekstual.

Pembelajaran CTL (Contextual

Teaching and Learning)

Pembelajarankontekstualmerupakan

salah satu pendekatan pembelajaran yang

menekankan pentingnya menghadirkan

lingkungan alamiah dalam proses pem-

belajaran agar siswa dalam proses pem-

belajaranmampumengembangkan diri dari

materi yang diterima dengan kondisi nyata

yangadadilingkungan.

Terdapat lima hal yang perlu di-

perhatikan bagi guru dalam penerapan

pembelajaran kontekstual yang disingkat

REACT (Nurhadi, 2006:23) yaitu sebagai

berikut:1.Relating.Belajardikaitkandengan

kehidupan nyata siswa, 2) Experiencting.

Belajar ditekankan pada penggalian atau

eksplorasi, penemuan atau diskoveri, dan

penciptan (inventional),3) Apllying.Belajar

bagaimana pengetahuan dipresentasikan

dalam konteks pemanfaatannya, 4) Coo-

perating.Belajarmelaluikontekskomunikasi

interpersonal pemahaman bersama dan

sebagainya, 5) Transfering, Belajar melalui

pemanfaatan pengetahuan di dalam situasi

ataukonteksbaru.

Selanjutnya Nurhadi (2006:33-34)

mengemukakan bahwa CTL (Contextual

Teaching and Learning) adalah salah satu

model pembelajaran yang menggunakan

pendekatan kontekstual. Pandangan CTL

(Contextual Teaching and Learning) tentang

belajaradalahsebagaiberikut:a)Belajartidak

hanyasekedarmenghafal,siswaharusdapat

mengkonstruksi sendiri pengetahuannya, b)

Anakbelajardaripengalaman,anakmencatat

sendiripolabermaknadaripengetahuanbaru

dantidakbegitusajamenerimapengetahuan

dariguru,c)Pengetahuantidakbisadipisah-

pisahmenjadifakta-faktaatauproporsiyang

terpisah, tapi mencerminkan keterampilan

yang diterapkan, d) Siswa perlu dibiasakan

memecahkan masalah menentukan sesuatu

yang berguna bagi dirinya sendiri dan

bergelut dengan ide-ide, c) Proses belajar

dapat mengubah struktur otak. Dalam

kontekspembelajarandalampendekatan ini

anak harus tahu makna belajar dan

bagaimana menggunakan pengetahuan dan

keterampilanyangdiperolehnyaolehkarena

itu transfer belajar diupayakan siswa

menjalanisendiri.

Berikutnya Nurhadi (2006:42-52)

menjelaskan bahwa penerapan pendekatan

kontekstualdikelas(ContextualTeachingand

Learning) sesuai dengan karakteristiknya

memiliki tujuh komponen yaitu kon-

strukstivisme (Construktivism), Inkuiri

(Inquiry),bertanya(Questioning),Masyarakat

belajar (Learning Comunity), Pemodelan

(Modeling),Re�kesi(Re�lection)danPenilaian

sebenarnya(AutenticAssesment).

KerangkaKonseptual

Agar penelitian dapat berlangsung

denganbaikdanmemberikankejelasanbaik

pada aspek berpikir maupun perilaku

penelitian maka perlu kerangka konseptual

yang mudah dipahami dan dilaksanakan

sesuai dengan tahapan-tahapan atau siklus

yang ditetapkan: 1) Kondisi Awal. Kondisi

awal merupakan kemampuan awal guru

dalam menyusun RPP kontekstual. Untuk

mendapatkan data awal para guru diminta

arsip RPP yang menurut mereka sudah

Kontekstual dan dipergunakan dalam

kegiatan pembelajaran; 2) Pemberian

Tindakan. Untuk peningkatan kemampuan

guru dalam menyusun RPP kontekstual

menggunakan tahapan (siklus) sebagai

berikut: a) Pada siklus pertama, guru

menyusun RPP kontekstual melalui diskusi

Matapelajarankecildenganmemperhatikan

hasilkerjaberupaRPPyangmenurutmereka

adalah Kontekstual. Hasil kerja (produk)

masing-masing guru tersebut dibahas

kembali dalam kelompok dan melalui

pembahasantersebutdiharapkansetiapguru

dapat menghasilkan produk baru. Produk

baru dapat berupa hasil review atau hasil

pegembangan produk yang lama, b) Pada

sikluskeduagurumenyusunRPPkontekstual

melaluitugasindividudenganharapandapat

menghasilkan produk RPP kontekstual yang

baik dan sesuai dengan yang diharapkan, c)

KondisiAkhir.Setelah diupayakan tindakan

melalui strategi Reading Guide baik secara

diskusikecildalamkelompokmaupunmelalui

tugas individu hasilnya dapat dibuktikan

bahwa strategi Reading Guide dapat

meningkatkanHasilkerjagurumenyusunRPP

kontekstualsesuaidenganyangdiharapkan.

Untuk lebih jelasnya kerangka ber�ikir

penelitian tindakan Mata pelajaran (PTS)

sebagaiberikut:

KONDISI AWAL

TINDAKAN

Penyusunan RPP

Kontekstual

melalui

strategi Reading Guide

Kondisi Akhir

Diduga bimbingan

menggunakan strategi

Reading Guide guru dapat

menyusunan RPP

Refleksi

Refleksi

SIKLUS I

Menyusun RPP

Kontekstual

teknik diskusi

Diperoleh

kemampuan

awal guru

menyusun RPP

SIKLUS II

Menyusun RPP

Kontekstual

dengan teknik

METODOLOGIPENELITIAN

SubyekPenelitian

Subyek penelitian diambil dari

sejumlah populasi yang ada sebanyak 100

guru dari 10 sekolah binaan. SD negeri di

Kecamatan Kundur . Mata pelajaran yang

diajarkanyaituTematik.Pengambilansubyek

penelitiandiantaranyadenganpertimbangan

bentuk penelitian yang digunakan adalah

penelitian tindakan. Selain itu merujuk

Page 16: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

16 17

pendapatNasution (1982:116) yangmenge-

mukakanbahwatidakadaaturanyangtegas

tentang jumlah sampel yang dipersyaratkan

untuk suatu penelitian dari populasi yang

tersedia.Jugatidakadabatasanyangjelasapa

yangdimaksuddengansampelyangbesardan

yang kecil. Dengan pertimbangan tersebut

untuk subyek penelitian ini adalah sebagai

berikut:

Tabel1.SubyekPenelitian

No. Namaguru AsalMatapelajaran MataPelajaran1 HAMSAR,S.Pd

SDN001

Tematik

2 ERLINDA,S.Pd

SDN004

Tematik3 SUMARIYATI,S.Pd.SD SDN006 Tematik4 ELI,S.Pd SDN007 Tematik5 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

6 MARISAHUQIE SDN011 Tematik

WaktuPenelitian

Penelitian tindakan sekolah (PTS)

dilakukan pada semester ganjil tahun

pelajaran 2017/2017 selama enam bulan.

Mulai dari persiapan sampai dengan

penulisanlaporanhasilPTS.Waktukegiatan

tampakpadatabelberikutini:

Tabel2.JadwalPenelitian

No KegiatanJuli Agustus Sep Okt Nop DesKelas Kelas Kelas Kelas Kelas Kelas

1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 41. Penyusunan

proposaldanperencanaantindakanI

2. PelaksanaantindakanI

3. Pengamatan/pengumpulandataI

4. Re�leksiI 5. Perencanaan

tindakanII 6. Pelaksanaan

tindakanII

7. Pengamatan/

pengumpulandataII

8. Re�leksiII9. Penulisan

laporan/penjilidan

TempatPenelitian

Penelitian Tindakan sekolah (PTS)

dilaksanakandi SekolahbinaanyaitudiSDN

001 SDN 004,006,007,009 dan SDN 011

Kecamatan Kundur Barat masing – masing

sekolah 1 orang , terdiri dari 6 sekolah .

Pemi l ihan tempat tersebut dengan

pertimbanganmudahdijangkauolehsekolah

binaanyangadadiKecamatanKundurBarat

dalamkegiatansupervisikunjungankelas.

ProsedurPenelitian

Agar penelitian dapat berlangsung

efektifdane�isienmakaprosedurpenelitian

yang harus dilakukan sebagai berikut: a)

Melakukansupervisiawaluntukmemperoleh

data awal sebagai bahan re�leksi dan

pertimbanganperlunyadilakukanpenelitian,

b) Menentukan rancangan penelitian yaitu

Penelitian Tindakan Sekolah (PTS), c)

Melakukan persiapan-persiapan, yaitu: 1)

Menyusun rencana penelitian, 2) Menyusun

skenario tindakan, 3) Menyusun instrumen

penelitian, 4) Mencari/menentukan ko-

laborator, 5) Menyiapkan alat evaluasi; d)

Menentukan tahapan setiap siklus yang

meliputi perencanaan (planning), tindakan

(acting), Observasi (observing) dan re�leksi

(re�lecting).

RancanganPenelitian

Rancanganpenelitianyangdilakukan

adalah Penelitian Tindakan Sekolah (PTS).

Penggunaan rancangan tersebut merujuk

Kemmis (1988, dalam Pusat Pengembangan

Tenaga Kependidikan Badan Pengembangan

Sumber Daya Manusia Pendidikan dan

Penjaminan Mutu Pendidikan, 2011) bahwa

penelitian tindakan adalah suatu bentuk

penelitian re�leksi diri yang dilakukan oleh

para partsipan dalam situasi-situasi sosial

(termasuk pendidikan) untuk memperbaiki

praktekyangdilakukansendiri.

Maksud memperbaiki praktek yang

dilakukansendiriadalahprosestindakandan

hasilyangdiperolehdariprosestindakanyang

dilakukan. Dalam hal penelitian ini praktek

pembimbingan melalui penelitian belum

tentu dapat dilaksanakan dengan baik oleh

pengawaspenelitisesuaidenganperencanaan

yangdisusun,olehkarenaitupraktekperludi

perbaikiataudikembangkan.

Penelitian kolaboratif dimaksud

dalampelaksanaanakandibantusatuorang

ataulebihyangperannyasebagaikolabolator.

Tugas kolabolator adalah melaksanakan

pengamatandalamprosespenelitian.Halini

sesuai dengan Moleong (dalam Zainal Aqib,

2003:105)yangmengemukakanbahwadalam

penelitian ini, karena teknik pengumpulan

datanya menggunakan observasi maka

keabsahandatadiperiksadengantriangulasi

penyidik,yaitudenganbantuanpengamatlain

sebagaikolaburator.

TeknikPengumpulanData

Teknik yang dipergunakan untuk

memperolehdatapenelitianadalahobservasi.

Penggunaan teknik observasi merujuk

pendapat Mastarmudi yang mengemukakan

bahwa observasi yang berarti pengamatan

bertujuan untuk mendapatkan data tentang

suatu masalah, sehingga diperoleh pe-

mahaman atau sebagai alat re-chack ingin

atau pembuktian terhadap informasi ke-

teranganyangdiperolehsebelumnya.Sebagi

metode ilmiah observasi biasa diartikan

sebagai pengamatan dan pencatatan

fenomena-fenomena yang diselidiki secara

sistematik. (http://mastarmudi.blogspot.

co.id/2010/07/pengertian-observasi.html)

Memahami pendapat tersebut ob-

servasi adalah sebuah kegiatan yang

dilakukan seseorang melalui pengamatan

dalam sebuah proses kegiatan dengan

menggunakan instrumen yang telah

ditentukanuntukmendapatkansejumlahdata

dari proses yangdiamati dan sesuai dengan

kebutuhanpenelitian.

Untuk menyusun instrumen pene-

litian dilakukan bersama kolaborator.

Instrumen yang dipergunakan untuk

mengumpulkan datameliputi: 1) instrumen

data re�leksi awal, 2) Format observasi

k e s e s u a i a n Re n c a n a Pe l a k s a n a a n

Pembimbingan(RPP)denganpelaksanaan,3)

Format penilaian hasil kerja (produk) guru

berupaRPPkontekstual.

Untuk mengukur tingkat kesesuaian

RPP dengan pelaksanaan menggunakan

rentangskorantara1–10denganklasi�ikasi

katagori sesuai, cukup sesuai dan kurang

sesuai. Lebih jelasnya sebagaimana tabel

berikutini:

Tabel3.RentanganSkorKesesuaianRPPdenganPBM

No Rentangskor TingkatKesesuaian1 1 –

4

KurangSesuai2 5– 7 CukupSesuai3 8– 10 Sesuai

Berikutnya untuk mengetahui kemampuan

guru menyusun RPP menggunakan tabel

rentanganskorsebagaiberikut:

Tabel4.RentanganskorhasilMenyusunRPP

No. RentanganSkor Katagori1 76

-

100

Sangat Baik

2 51- 75 Baik3 26

-

50

CukupBaik4 0- 25 KurangBaik

AnalisisData

Datayangtelahdiperolehlebihlanjut

dikumpulkandandiklasi�ikasisesuaidengan

kebutuhan analisis data.Hasil akhir analisis

data dipergunakan sebagai bahan pe-

ngambilan simpulan. Untuk anlisis data

merujuk pendapatMilesHuberman (dalam

Zainal Aqib, 2006:108) yang menyebutkan

bahwa data dianalisa bersama mitra

kolaburasi sejak penelitian dimulai, yang

dikembangkanselamaprosesre�leksisampai

penyusunan laporan. Teknik analisis data

Page 17: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

16 17

pendapatNasution (1982:116) yangmenge-

mukakanbahwatidakadaaturanyangtegas

tentang jumlah sampel yang dipersyaratkan

untuk suatu penelitian dari populasi yang

tersedia.Jugatidakadabatasanyangjelasapa

yangdimaksuddengansampelyangbesardan

yang kecil. Dengan pertimbangan tersebut

untuk subyek penelitian ini adalah sebagai

berikut:

Tabel1.SubyekPenelitian

No. Namaguru AsalMatapelajaran MataPelajaran1 HAMSAR,S.Pd

SDN001

Tematik

2 ERLINDA,S.Pd

SDN004

Tematik3 SUMARIYATI,S.Pd.SD SDN006 Tematik4 ELI,S.Pd SDN007 Tematik5 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

6 MARISAHUQIE SDN011 Tematik

WaktuPenelitian

Penelitian tindakan sekolah (PTS)

dilakukan pada semester ganjil tahun

pelajaran 2017/2017 selama enam bulan.

Mulai dari persiapan sampai dengan

penulisanlaporanhasilPTS.Waktukegiatan

tampakpadatabelberikutini:

Tabel2.JadwalPenelitian

No KegiatanJuli Agustus Sep Okt Nop DesKelas Kelas Kelas Kelas Kelas Kelas

1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 41. Penyusunan

proposaldanperencanaantindakanI

2. PelaksanaantindakanI

3. Pengamatan/pengumpulandataI

4. Re�leksiI 5. Perencanaan

tindakanII 6. Pelaksanaan

tindakanII

7. Pengamatan/

pengumpulandataII

8. Re�leksiII9. Penulisan

laporan/penjilidan

TempatPenelitian

Penelitian Tindakan sekolah (PTS)

dilaksanakandi SekolahbinaanyaitudiSDN

001 SDN 004,006,007,009 dan SDN 011

Kecamatan Kundur Barat masing – masing

sekolah 1 orang , terdiri dari 6 sekolah .

Pemi l ihan tempat tersebut dengan

pertimbanganmudahdijangkauolehsekolah

binaanyangadadiKecamatanKundurBarat

dalamkegiatansupervisikunjungankelas.

ProsedurPenelitian

Agar penelitian dapat berlangsung

efektifdane�isienmakaprosedurpenelitian

yang harus dilakukan sebagai berikut: a)

Melakukansupervisiawaluntukmemperoleh

data awal sebagai bahan re�leksi dan

pertimbanganperlunyadilakukanpenelitian,

b) Menentukan rancangan penelitian yaitu

Penelitian Tindakan Sekolah (PTS), c)

Melakukan persiapan-persiapan, yaitu: 1)

Menyusun rencana penelitian, 2) Menyusun

skenario tindakan, 3) Menyusun instrumen

penelitian, 4) Mencari/menentukan ko-

laborator, 5) Menyiapkan alat evaluasi; d)

Menentukan tahapan setiap siklus yang

meliputi perencanaan (planning), tindakan

(acting), Observasi (observing) dan re�leksi

(re�lecting).

RancanganPenelitian

Rancanganpenelitianyangdilakukan

adalah Penelitian Tindakan Sekolah (PTS).

Penggunaan rancangan tersebut merujuk

Kemmis (1988, dalam Pusat Pengembangan

Tenaga Kependidikan Badan Pengembangan

Sumber Daya Manusia Pendidikan dan

Penjaminan Mutu Pendidikan, 2011) bahwa

penelitian tindakan adalah suatu bentuk

penelitian re�leksi diri yang dilakukan oleh

para partsipan dalam situasi-situasi sosial

(termasuk pendidikan) untuk memperbaiki

praktekyangdilakukansendiri.

Maksud memperbaiki praktek yang

dilakukansendiriadalahprosestindakandan

hasilyangdiperolehdariprosestindakanyang

dilakukan. Dalam hal penelitian ini praktek

pembimbingan melalui penelitian belum

tentu dapat dilaksanakan dengan baik oleh

pengawaspenelitisesuaidenganperencanaan

yangdisusun,olehkarenaitupraktekperludi

perbaikiataudikembangkan.

Penelitian kolaboratif dimaksud

dalampelaksanaanakandibantusatuorang

ataulebihyangperannyasebagaikolabolator.

Tugas kolabolator adalah melaksanakan

pengamatandalamprosespenelitian.Halini

sesuai dengan Moleong (dalam Zainal Aqib,

2003:105)yangmengemukakanbahwadalam

penelitian ini, karena teknik pengumpulan

datanya menggunakan observasi maka

keabsahandatadiperiksadengantriangulasi

penyidik,yaitudenganbantuanpengamatlain

sebagaikolaburator.

TeknikPengumpulanData

Teknik yang dipergunakan untuk

memperolehdatapenelitianadalahobservasi.

Penggunaan teknik observasi merujuk

pendapat Mastarmudi yang mengemukakan

bahwa observasi yang berarti pengamatan

bertujuan untuk mendapatkan data tentang

suatu masalah, sehingga diperoleh pe-

mahaman atau sebagai alat re-chack ingin

atau pembuktian terhadap informasi ke-

teranganyangdiperolehsebelumnya.Sebagi

metode ilmiah observasi biasa diartikan

sebagai pengamatan dan pencatatan

fenomena-fenomena yang diselidiki secara

sistematik. (http://mastarmudi.blogspot.

co.id/2010/07/pengertian-observasi.html)

Memahami pendapat tersebut ob-

servasi adalah sebuah kegiatan yang

dilakukan seseorang melalui pengamatan

dalam sebuah proses kegiatan dengan

menggunakan instrumen yang telah

ditentukanuntukmendapatkansejumlahdata

dari proses yangdiamati dan sesuai dengan

kebutuhanpenelitian.

Untuk menyusun instrumen pene-

litian dilakukan bersama kolaborator.

Instrumen yang dipergunakan untuk

mengumpulkan datameliputi: 1) instrumen

data re�leksi awal, 2) Format observasi

k e s e s u a i a n Re n c a n a Pe l a k s a n a a n

Pembimbingan(RPP)denganpelaksanaan,3)

Format penilaian hasil kerja (produk) guru

berupaRPPkontekstual.

Untuk mengukur tingkat kesesuaian

RPP dengan pelaksanaan menggunakan

rentangskorantara1–10denganklasi�ikasi

katagori sesuai, cukup sesuai dan kurang

sesuai. Lebih jelasnya sebagaimana tabel

berikutini:

Tabel3.RentanganSkorKesesuaianRPPdenganPBM

No Rentangskor TingkatKesesuaian1 1 –

4

KurangSesuai2 5– 7 CukupSesuai3 8– 10 Sesuai

Berikutnya untuk mengetahui kemampuan

guru menyusun RPP menggunakan tabel

rentanganskorsebagaiberikut:

Tabel4.RentanganskorhasilMenyusunRPP

No. RentanganSkor Katagori1 76

-

100

Sangat Baik

2 51- 75 Baik3 26

-

50

CukupBaik4 0- 25 KurangBaik

AnalisisData

Datayangtelahdiperolehlebihlanjut

dikumpulkandandiklasi�ikasisesuaidengan

kebutuhan analisis data.Hasil akhir analisis

data dipergunakan sebagai bahan pe-

ngambilan simpulan. Untuk anlisis data

merujuk pendapatMilesHuberman (dalam

Zainal Aqib, 2006:108) yang menyebutkan

bahwa data dianalisa bersama mitra

kolaburasi sejak penelitian dimulai, yang

dikembangkanselamaprosesre�leksisampai

penyusunan laporan. Teknik analisis data

Page 18: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

18 19

yang digunakan adalah model alur, yaitu

reduksi data, penyajian data dan penarikan

simpulan.

HASIL DAN PEMBAHASAN

Hasilobservasiawaladalahdatayang

diperoleh sebelum dilakukan penelitian

tindakandandatatersebutdigunakansebagi

pertimbanganperlunyadilakukanpenelitian.

Datayangdiperolehsebagaiberikut:

Tabel5.HasilkerjaawalgurumenyusunRPPkontekstual

NoNamaGuru

AsalMatapelajaran

PerolehanSkor

PenelitiKola

boratorRata-rata

Katagori

1 HAMSAR,S.Pd

SDN001

54.4

54.4 Baik2 ERLINDA,S.Pd

SDN004

54.6

54.6 Baik

3 SUMARIYATI,S.Pd.SD

SDN

006

59.6

59.6 Baik4 ELI,S.Pd SDN007 58 58 Baik5 ERNIMAYSITA,S.Pd.SD

SDN009

58.1

58.1 Baik

6 MARISAHUQIE

SDN011

58.9

58.9 Baik

Jumlah 343.6343.6

Baik

Rata-rata 57.2757.27

Sumber:RPPhasilpekerjaanguru

DataHasilPenelitianSiklusI

Perencanaan (planing), Untuk

tindakansiklus Imemerlukanwaktu6X45

menit . Topik materi: Menyusun RPP

kontekstual. Materinya tentang sembilan

komponen dan prinsip-prinsip penyusunan

RPP. Strategi penyampaian materi adalah

ReadingGuide. Metodepenyampaianadalah

ceramah,diskusikelompok.danstrategiyang

dipergunakanadalahstrategiAktif Reading

Guide.

Penyajian materi dengan skenario

berikut:1)Pengawaspenelitimenyampaikan

pokokmaterimelaluiceramah,diskusiMata

pelajarankecil,2)MenyiapkandanMenyusun

RPP; 3) Mengajak kolabolator dalam

membantu menyiapkan pengamatan; 4)

Melakukanpengamatandanpenilaian

Pelaksanaan, Tahapan-tahapan tin-

dakansiklusIsebagaiberikut:1)Pendahuluan

Pengawas peneliti menyampaikan tujuan

pembimbingan dan inti materi yang akan

d iber ikan . Penyampaian aperseps i ,

penyampaian tujuan bimbingan, dan

pemberianmotivasi.KegiatanInti,a)Peneliti

menyampaikan konsepmateri secara umum

tentang pentingnya RPP kontekstual, b)

Penyampaian contoh RPP kontekstual dan

RPPbukanKontekstual,c)Pengawaspeneliti

memberikesempatanguruuntukbertanya,d)

Pembentukan kelompok kerja dan setiap

kelompok beranggotakan 2 orang; e) Guru

diminta menyiapkan RPP kontekstual yang

telah disiapkan sebelumnya oleh masing-

masingguru;f)Gurudimintamendiskusikan

hasilkerjakelompok;g)Setiapgurudiminta

mempresentasikan hasil kerja/produk RPP

yangtelahdisusun;h)Gurudimintamerespon

hasil setiap presentasi; i) Pengawas peneliti

mengulas setiap hasil prestasi setelah

interaksiantarguruberlangsung;j)Pengawas

penelitimemberikanwaktuuntukmelakukan

kon�irmasi hasil kerja kelompok setelah

pengawas penelitimengulasRPPhasilkerja

guru; k) Pengawas peneliti memberikan

kesimpulanhasilkerjaseluruhguru.Penutup

a)Pengawaspenelitimemberikankesimpulan

hasil kerja guru; b) Pengawas peneliti

memintagurumengumpulkanRPPhasilkerja

individu; c) Pengawas peneliti melakukan

re� leksi proses b imbingan sebelum

meninggalkan ruangan dan dilanjutkan

menyampaikan rencana materi yang akan

datang Kegiatan di akhiri dengan ucapan

salam.

Pengamatan (observasi),Observasi

(pengamatan)selamapenelitianpadasiklusI

berlangsung dilakukan bersama oleh

pengawas peneliti dan kolaborator. Pe-

ngamatanyangdilakukansebagaiberikut:1)

Pengawaspenelitimelaksanakanpengamatan

untukguru selamamengikuti bimbingan;2)

Kolaborator melakukan pengamatan untuk

guru dan pengawas peneliti; 3) Hasil

pengamatansiklusIdisajikanberturut-turut

meliputi sebagai berikut: a) Proses

bimbingan, b) Kegiatan guru selama

mengikuti bimbingan, c) Hasil kerja guru

menyusun RPP kontekstual meliputi

komponenyangadapadaRPP.

HasilPengamatanprosesbimbingan

Tabel 6. Hasil Observasi pelaksanaan RPPdengan penerapan s t ra teg iReadingGuidepadabimbinganguruSiklusI

No. Aspekkegiatan Skor Katagori

A Pendahuluan1.Penyampaianapersepsi 7 CukupSesuai2.Penyampaiantujuanpembelajaran 4 KurangSesuai3.Pemberianmotivasi 5 CukupSesuaiJumlah 16Rata-rata 5.3 CukupSesuai

B KegiatanInti1.Eksplorasia.Penelitimenyampaikankonsepmaterisecaraumum

tentangpentingnyaRPPkontekstual 4 KurangSesuaib.PenyampaiancontohRPPkontekstualdanRPP

bukanKontekstual

5

CukupSesuaic.Pengawaspenelitimemberikesempatanguru

untukbertanya

8

Sesuaid.PembentukanMatapelajaran

kerjadansetiapMatapelajaran

beranggotakan2orang

7

CukupSesuaie.GurudimintamenyiapkanRPPkontekstualyangte

lahdisiapkansebelumnyaolehmasing-masingguru

6

CukupSesuaif.GurudimintamendiskusikanhasilkerjaMata

pelajaran.

8

Sesuai

g.Setiapgurudimintamempresentasikanhasil

kerja/produkRPPyangtelahdisusun

7

CukupSesuai

Jumlah 45Rata-rata 6.4 Cukupsesui

2.Elaborasi

a.Gurudimintameresponhasilsetiappresentasi

6

CukupSesuaib.Pengawaspenelitimengulassetiaphasilprestasi

7

CukupSesuaisetelahinteraksiantarguruberlangsung

Jumlah 13Rata-rata 6.5 CukupSesuai3.Kon�irmasi

a.Pengawaspenelitimemberikanwaktuuntukmela-

kukankon�irmasihasilkerjaMatapelajaran

setelahpe-

ngawaspenelitimengulasRPPhasilkerjaguru

8

Sesuaib.Pengawaspenelitimemberikankesimpulanhasilkerja

seluruhguru

8

Sesuai

Jumlah 16Rata-rata 8 SesuaiJumlahrata-ratakegaiataninti 21Rata-rata 7 Cukupsesuai

C Penutupa.Pengawaspenelitimemberikankesimpulanhasilkerjaguru. 5 CukupSesuai

b.PengawaspenelitimemintagurumengumpulkanRPPhasilkerjaindividu 8 Sesuai

c.Pengawas penelitimelakukanre�leksiprosesbim-sebelummneinggalkanruangandandilanjuSDanmenyampaikanrencanamateriyangakandatang

Kegiatandiakhiridenganucapansalam.

8

SesuaiJumlah 21 Rata-rata 7

Cukupsesuai

Rata-ratakeseluruhan(A+B+C)/3 6.4 Cukupsesui

Hasil kerja gurumenyusunRPPkontekstual

Hasil kerja guru secara kumulatif untuk

menyusun RPP kontekstual (lampiran 7)

tampak pada tabel di bawah ini, sebagai

berikut:

Tabel7.NilaihasilkerjagurumenyusunRPPkontekstualSiklusI

No NamaAsal

SekolahMata

pelajaran

Nilai

P KRata-rata

Katagori

1 HAMSAR,S.Pd

SDN001

Tematik

62.3

65 63.65Baik

2 ERLINDA,S.Pd

SDN004

Tematik

60.8

65.4 63.1Baik

3 SUMARIYATI,S.Pd.SD SDN 006 Tematik 62.3

65 63.65

Baik

4 ELI,S.Pd SDN007

Tematik

61.4

66.1 63.75

Baik

5 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

62.4

67 64.7Baik

6 MARISAHUQIE SDN011 Tematik62.8

66.466.4

64.664.6

Baik

Rata-rata Baik

Sumber: RPPH hasil pekerjaan guru.P: Pengawas; K: Kolaborator

Re�leksi (Re�lecting), Re�leksi

merupakankegiatanuntukmemperolehdata

dari sebuah proses kegiatan yang sudah

dilaksanakan. Data yang diperoleh sebagai

bahansebagaibahanre�leksiuntukdilakukan

perbaikandanpengembanganpadasikluske

II.Hasilre�leksicukupmaupunkurangsesuai

dengan ukuran skor yang ditentukan baik

untukhasilre�leksisiklusIsebagaiberikut:1)

Penyampaiantujuanbimbingankurangjelas;

2) Pemberian motivasi belum maksimal; 3)

Penyampaikan konsep materi secara umum

tentang pentingnya RPP kontekstual kurang

jelas;4)PenyampaiancontohRPPkontekstual

dan RPP bukan Kontekstual belum jelas; 5)

Pengawas peneliti dalam memberi ke-

simpulanhasilkerjagurubelumcukupsesuai.

UntuktindakansiklusIImemerlukan

waktu6X40menit.Topikmateri:Menyusun

RPP kontekstual. Materinya tentang

sembilan komponen dan prinsip-prinsip

penyusunan RPP. Strategi penyampaian

materi adalah Reading Guide. Metode

penyampaianadalahceramah,tugasmandiri.

dan strategi yang dipergunakan adalah

strategiAktifReadingGuide.

Penyajian materi dengan skenario

berikut:1)Pengawaspenelitimenyampaikan

pokokmaterimelaluiceramah,tugasmandiri;

2) Menyiapkan dan Menyusun RPP; 3)

Page 19: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

18 19

yang digunakan adalah model alur, yaitu

reduksi data, penyajian data dan penarikan

simpulan.

HASIL DAN PEMBAHASAN

Hasilobservasiawaladalahdatayang

diperoleh sebelum dilakukan penelitian

tindakandandatatersebutdigunakansebagi

pertimbanganperlunyadilakukanpenelitian.

Datayangdiperolehsebagaiberikut:

Tabel5.HasilkerjaawalgurumenyusunRPPkontekstual

NoNamaGuru

AsalMatapelajaran

PerolehanSkor

PenelitiKola

boratorRata-rata

Katagori

1 HAMSAR,S.Pd

SDN001

54.4

54.4 Baik2 ERLINDA,S.Pd

SDN004

54.6

54.6 Baik

3 SUMARIYATI,S.Pd.SD

SDN

006

59.6

59.6 Baik4 ELI,S.Pd SDN007 58 58 Baik5 ERNIMAYSITA,S.Pd.SD

SDN009

58.1

58.1 Baik

6 MARISAHUQIE

SDN011

58.9

58.9 Baik

Jumlah 343.6343.6

Baik

Rata-rata 57.2757.27

Sumber:RPPhasilpekerjaanguru

DataHasilPenelitianSiklusI

Perencanaan (planing), Untuk

tindakansiklus Imemerlukanwaktu6X45

menit . Topik materi: Menyusun RPP

kontekstual. Materinya tentang sembilan

komponen dan prinsip-prinsip penyusunan

RPP. Strategi penyampaian materi adalah

ReadingGuide. Metodepenyampaianadalah

ceramah,diskusikelompok.danstrategiyang

dipergunakanadalahstrategiAktif Reading

Guide.

Penyajian materi dengan skenario

berikut:1)Pengawaspenelitimenyampaikan

pokokmaterimelaluiceramah,diskusiMata

pelajarankecil,2)MenyiapkandanMenyusun

RPP; 3) Mengajak kolabolator dalam

membantu menyiapkan pengamatan; 4)

Melakukanpengamatandanpenilaian

Pelaksanaan, Tahapan-tahapan tin-

dakansiklusIsebagaiberikut:1)Pendahuluan

Pengawas peneliti menyampaikan tujuan

pembimbingan dan inti materi yang akan

d iber ikan . Penyampaian aperseps i ,

penyampaian tujuan bimbingan, dan

pemberianmotivasi.KegiatanInti,a)Peneliti

menyampaikan konsepmateri secara umum

tentang pentingnya RPP kontekstual, b)

Penyampaian contoh RPP kontekstual dan

RPPbukanKontekstual,c)Pengawaspeneliti

memberikesempatanguruuntukbertanya,d)

Pembentukan kelompok kerja dan setiap

kelompok beranggotakan 2 orang; e) Guru

diminta menyiapkan RPP kontekstual yang

telah disiapkan sebelumnya oleh masing-

masingguru;f)Gurudimintamendiskusikan

hasilkerjakelompok;g)Setiapgurudiminta

mempresentasikan hasil kerja/produk RPP

yangtelahdisusun;h)Gurudimintamerespon

hasil setiap presentasi; i) Pengawas peneliti

mengulas setiap hasil prestasi setelah

interaksiantarguruberlangsung;j)Pengawas

penelitimemberikanwaktuuntukmelakukan

kon�irmasi hasil kerja kelompok setelah

pengawas penelitimengulasRPPhasilkerja

guru; k) Pengawas peneliti memberikan

kesimpulanhasilkerjaseluruhguru.Penutup

a)Pengawaspenelitimemberikankesimpulan

hasil kerja guru; b) Pengawas peneliti

memintagurumengumpulkanRPPhasilkerja

individu; c) Pengawas peneliti melakukan

re� leksi proses b imbingan sebelum

meninggalkan ruangan dan dilanjutkan

menyampaikan rencana materi yang akan

datang Kegiatan di akhiri dengan ucapan

salam.

Pengamatan (observasi),Observasi

(pengamatan)selamapenelitianpadasiklusI

berlangsung dilakukan bersama oleh

pengawas peneliti dan kolaborator. Pe-

ngamatanyangdilakukansebagaiberikut:1)

Pengawaspenelitimelaksanakanpengamatan

untukguru selamamengikuti bimbingan;2)

Kolaborator melakukan pengamatan untuk

guru dan pengawas peneliti; 3) Hasil

pengamatansiklusIdisajikanberturut-turut

meliputi sebagai berikut: a) Proses

bimbingan, b) Kegiatan guru selama

mengikuti bimbingan, c) Hasil kerja guru

menyusun RPP kontekstual meliputi

komponenyangadapadaRPP.

HasilPengamatanprosesbimbingan

Tabel 6. Hasil Observasi pelaksanaan RPPdengan penerapan s t ra teg iReadingGuidepadabimbinganguruSiklusI

No. Aspekkegiatan Skor Katagori

A Pendahuluan1.Penyampaianapersepsi 7 CukupSesuai2.Penyampaiantujuanpembelajaran 4 KurangSesuai3.Pemberianmotivasi 5 CukupSesuaiJumlah 16Rata-rata 5.3 CukupSesuai

B KegiatanInti1.Eksplorasia.Penelitimenyampaikankonsepmaterisecaraumum

tentangpentingnyaRPPkontekstual 4 KurangSesuaib.PenyampaiancontohRPPkontekstualdanRPP

bukanKontekstual

5

CukupSesuaic.Pengawaspenelitimemberikesempatanguru

untukbertanya

8

Sesuaid.PembentukanMatapelajaran

kerjadansetiapMatapelajaran

beranggotakan2orang

7

CukupSesuaie.GurudimintamenyiapkanRPPkontekstualyangte

lahdisiapkansebelumnyaolehmasing-masingguru

6

CukupSesuaif.GurudimintamendiskusikanhasilkerjaMata

pelajaran.

8

Sesuai

g.Setiapgurudimintamempresentasikanhasil

kerja/produkRPPyangtelahdisusun

7

CukupSesuai

Jumlah 45Rata-rata 6.4 Cukupsesui

2.Elaborasi

a.Gurudimintameresponhasilsetiappresentasi

6

CukupSesuaib.Pengawaspenelitimengulassetiaphasilprestasi

7

CukupSesuaisetelahinteraksiantarguruberlangsung

Jumlah 13Rata-rata 6.5 CukupSesuai3.Kon�irmasi

a.Pengawaspenelitimemberikanwaktuuntukmela-

kukankon�irmasihasilkerjaMatapelajaran

setelahpe-

ngawaspenelitimengulasRPPhasilkerjaguru

8

Sesuaib.Pengawaspenelitimemberikankesimpulanhasilkerja

seluruhguru

8

Sesuai

Jumlah 16Rata-rata 8 SesuaiJumlahrata-ratakegaiataninti 21Rata-rata 7 Cukupsesuai

C Penutupa.Pengawaspenelitimemberikankesimpulanhasilkerjaguru. 5 CukupSesuai

b.PengawaspenelitimemintagurumengumpulkanRPPhasilkerjaindividu 8 Sesuai

c.Pengawas penelitimelakukanre�leksiprosesbim-sebelummneinggalkanruangandandilanjuSDanmenyampaikanrencanamateriyangakandatang

Kegiatandiakhiridenganucapansalam.

8

SesuaiJumlah 21 Rata-rata 7

Cukupsesuai

Rata-ratakeseluruhan(A+B+C)/3 6.4 Cukupsesui

Hasil kerja gurumenyusunRPPkontekstual

Hasil kerja guru secara kumulatif untuk

menyusun RPP kontekstual (lampiran 7)

tampak pada tabel di bawah ini, sebagai

berikut:

Tabel7.NilaihasilkerjagurumenyusunRPPkontekstualSiklusI

No NamaAsal

SekolahMata

pelajaran

Nilai

P KRata-rata

Katagori

1 HAMSAR,S.Pd

SDN001

Tematik

62.3

65 63.65Baik

2 ERLINDA,S.Pd

SDN004

Tematik

60.8

65.4 63.1Baik

3 SUMARIYATI,S.Pd.SD SDN 006 Tematik 62.3

65 63.65

Baik

4 ELI,S.Pd SDN007

Tematik

61.4

66.1 63.75

Baik

5 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

62.4

67 64.7Baik

6 MARISAHUQIE SDN011 Tematik62.8

66.466.4

64.664.6

Baik

Rata-rata Baik

Sumber: RPPH hasil pekerjaan guru.P: Pengawas; K: Kolaborator

Re�leksi (Re�lecting), Re�leksi

merupakankegiatanuntukmemperolehdata

dari sebuah proses kegiatan yang sudah

dilaksanakan. Data yang diperoleh sebagai

bahansebagaibahanre�leksiuntukdilakukan

perbaikandanpengembanganpadasikluske

II.Hasilre�leksicukupmaupunkurangsesuai

dengan ukuran skor yang ditentukan baik

untukhasilre�leksisiklusIsebagaiberikut:1)

Penyampaiantujuanbimbingankurangjelas;

2) Pemberian motivasi belum maksimal; 3)

Penyampaikan konsep materi secara umum

tentang pentingnya RPP kontekstual kurang

jelas;4)PenyampaiancontohRPPkontekstual

dan RPP bukan Kontekstual belum jelas; 5)

Pengawas peneliti dalam memberi ke-

simpulanhasilkerjagurubelumcukupsesuai.

UntuktindakansiklusIImemerlukan

waktu6X40menit.Topikmateri:Menyusun

RPP kontekstual. Materinya tentang

sembilan komponen dan prinsip-prinsip

penyusunan RPP. Strategi penyampaian

materi adalah Reading Guide. Metode

penyampaianadalahceramah,tugasmandiri.

dan strategi yang dipergunakan adalah

strategiAktifReadingGuide.

Penyajian materi dengan skenario

berikut:1)Pengawaspenelitimenyampaikan

pokokmaterimelaluiceramah,tugasmandiri;

2) Menyiapkan dan Menyusun RPP; 3)

Page 20: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

20 21

Mengajak kolabolator dalam membantu

menyiapkan pengamatan; 3) Melakukan

pengamatandanpenilaian

Tahapan-tahapan tindakan siklus II

sebagai berikut: 1) Pendahuluan Pengawas

peneliti menyampaikan tujuan pem-

bimbingan dan inti materi yang akan

diberikan. Penyampaian apersepsi, pe-

nyampaiantujuanbimbingan,danpemberian

motivasi; 2) Kegiatan Inti: a) Peneliti

menyampaikankonsepmaterisecaraumum

tentang pentingnya RPP kontekstual, b)

Penyampaian contoh RPP kontekstual dan

RPPbukanKontekstual,c)Pengawaspeneliti

memberikesempatanguruuntukbertanya,d)

Guru diminta melihat kembali �ile RPP

kontekstual untuk dikaji ulang sekaligus

sebagai referensi menyusun ulang RPP

kontekstual, e) Setiap guru diminta mem-

presentasikan hasil kerja penyusunan RPP

kontekstual,f)Setiapgurudimintamerespon

hasil setiapPersentasi,g)Pengawaspeneliti

mengulas setiap hasil prestasi setelah

interaksi antar guru, h) Pengawas peneliti

memberikan waktu untuk melakukan

kon�irmasi hasil ulang setelah Pengawas

peneliti mengulas hasil kerja guru, i)

Pengawas penelitimemberikan kesempatan

kepada guru untuk mengkon�irmasi hasil

kerjanya; 3) Penutup.a) Pengawas mene-

gaskankembali intimateridanmemberikan

kesimpulan hasil kerja guru; b) Pengawas

peneliti meminta guru mengumpulkan RPP

hasil tugas individu; c) Pengawas peneliti

melakukan re�leksi proses bimbingan

sebelummengakhirikegiatandandilanjutkan

dengan permintaan agar hasil kerja yang

Sudah baik untuk dikembangkan sehingga

menjadi lebih sempurna. Kegiatan diakhiri

denganucapansalam.

Pengamatan (observasi), Observasi

(pengamatan)selamapenelitianpadasiklusI

berlangsung dilakukan bersama oleh

pengawas penel i t i dan kolaborator.

Pengamatanyangdilakukansebagaiberikut:

1) Pengawas penelit i melaksanakan

pengamatan untuk guru selama mengikuti

bimbingan; 2) Kolaborator melakukan

pengamatan untuk guru dan pengawas

peneliti.HasilpengamatansiklusIIdisajikan

berturut-turut meliputi sebagai berikut: a)

Prosesbimbingan; b)Kegiatanguruselama

mengikuti bimbingan; c) Hasil kerja guru

menyusun RPP kontekstual meliputi

komponen yang ada pada RPP; d) Hasil

Pengamatan proses bimbingan. Setelah

pengamatan dilakukan oleh kolaborator

tentang penerapan rencana bimbingaan,

hasilnya sebagaimana pada tabel sebagai

berikut:

Tabel 8. Hasil Observasi penerapan RPPstrategiReadingGuidepadaprosesbimbinganSiklusII

No. Aspekkegiatan Skor Katagori

A Pendahuluan1.Penyampaianapersepsi 8 Sesuai2.Penyampaiantujuanbimbingan 8 Sesuai3.Pemberianmotivasi 8 SesuaiJumlah 24Rata-rata 8 Sesuai

B KegiatanInti1.Eksplorasia.Penelitimenyampaikankonsepmaterisecara

umumtentangpentingnyaRPPkontekstual

8 Sesuaib.PenyampaiancontohRPPkontekstualdan

bukanKontekstualdanmenjelaskanbedanya

7 CukupSesuaic.Pengawaspenelitimemberikesempatan

guru untukbertanya

9 Sesuaid.Gurudimintamelihatkembali�ileRPP

konteks-

tualuntukdikajiulangsekaligussebagaireferensi

menyusunulangRPPkontekstual

8 Sesuaie.Setiapgurudimintamempresentasikanhasil

kerjapenyusunanRPPkontekstual

8 SesuaiJumlah 40Rata-rata 8 Sesuai

2.Elaborasia.Setiapgurudimintameresponhasilsetiap

Persentasi

8 Sesuai

b.Pengawaspenelitimengulassetiaphasil

prestasisetelahinteraksiantarguru.

8 SesuaiJumlah 16Rata-rata 8 Sesuai

3.Kon�irmasi

a.Pengawaspenelitimemberikanwaktuuntuk

melakukankon�irmasihasilulangsetelah

Pengawaspenelitimengulashasilkerjaguru

8 Sesuaib.Pengawaspenelitimemberikankesempatankepa-

daguruuntukmengkon�irmasihasilkerjanya

8 SesuaiJumlah 16Rata-rata 8 SesuaiJumlahKegiatanInti 24Rata-rata 8 Sesuai

C Penutupa.Pengawasmenegaskankembaliintimateridanmemberikankesimpulanhasilkerjaguru 8 Sesuai

b.PengawaspenelitimemintagurumengumPulkanRPPhasiltugasindividu 8 Sesuai

c.Pengawaspenelitimelakukanre�leksiprosesbimbingansebelummengakhirikegiatandandilanjutkandenganpermintaanagarhasilkerjayang

Sudahbaikuntukdikembangkansehinggamenja-dilebihsempurna.Kegiatandiakhiridenganucapansalam.

8 Sesuai

Jumlah 24Rata-rata 8 SesuaiRata-ratakeseluruhan(A+B+C)/3 8 Sesuai

No. Aspekkegiatan Skor Katagori

a. KemampuanmenyusunRPPkontekstual

Setelah dilakukan penilaian atas hasil

pekerjaan setiap guru yakni berupa RPP

kontekstual, dan hasil tersebut dikaji dari

hasilrata-ratasetiapRPPkontekstualtampak

padatabelberikutini:

Tabel 9. Hasil kerja guru menyusun RPPkontekstualSiklusII

No NamaAsalSekolah

Matapelajaran

Nilai

PK

Rata-rata

Katagori

1 HAMSAR,S.Pd SDN001

Tematik

79.4

80.7 80.05SB

2 ERLINDA,S.Pd SDN004

Tematik

80.1

82.5 81.3SB

3 SUMARIYATI,S.Pd.SD SDN006 Tematik 80.3

82.3 81.3

SB

4 ELI,S.Pd SDN007

Tematik

81.9

83.3 82.6

SB

5ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

82.4

84.6 83.5SB

6 MARISAHUQIE SDN011 Tematik80.1 83.5 81.8

SB

Rata-rata 80.7 82.81

Sumber : RPP hasil pekerjaan guru.P : Pengawas; K : Kolaborator

a.Re�lekting(Re�lecting)

Sebagaimana pelaksanaan re�leksi

pada siklus I, pada siklus II bahwa yang

dilakukan berkenaan dengan proses

bimbingan dan hasil dari proses itu sendiri.

Berdasarkan asil temuan pada siklus II

terutama adanya kekurangan, maka temuan

tersebut akan dijadikan pertimbangan pada

penelitianyangakandatang.

Pembahasan

Sebelumpembahasanhasilpenelitian

dilakukan,terlebihdahuluakanmemaparkan

setiap aspek yang diobservasi dan data

tersebut dimasukkan/ diklasi�ikasi dalam

satu kolom. Tujuannya untuk memudahkan

melihatperkembanganprosesdanhasilsetiap

siklus.Selainituuntukmempermudahdalam

pengambilansimpulan.Tahapanpembahasan

akan disesuaikan dengan urutan masalah

penelitian yang telah dirumuskan, sebagai

berikut:

Penyajian data hasil pengamatan

proses bimbingan dalam bentuk skor rata-

rata.DatameliputidatasiklusIdanII,yaitu

sebagaiberikut:

Tabel 10. Skor rata-rata aspek pelaksanaanRKPsiklusIdanII

No. AspekkegiatanSiklusI SiklusII

Skor Katagori Skor KatagoriA Pendahuluan(Rata-rata)

5,3CukupSesuai

8,0Sesuai

B KegiatanInti

1.Eksplorasi(Rata-rata)

6,4

CukupSesuai

8,0

Sesuai

2.Elaborasi(Rata-rata)

6,5 CukupSesuai 8,0

Sesuai

3.Kon�irmasi(Rata-rata)

7,0

CukupSesuai

8,0Sesuai

C Penutup(Rata-rata)

7,0

CukupSesuai

8,0Sesuai

Jumlah 18,9 40,0Rata-ratakeseluruhan(A+B+C)/3

6,3CukupSesuai

8,0Sesuai

Ket:CS(CukupSesuai)

Memperhatikantabeldiatasdapatdipahami

bahwaprosesbimbingansiklusIpadaaspek

pendahuluan menunjukkan skor rata-rata

sebesar 5,3 atau dengan katagori “Cukup

sesuai”. Pada sub aspek ini masih terdapat

pelaksanaanyangkurangmaksimalyaitupada

penyampaian tujuan dengan skor 4,0 atau

dengan katagori “Kurang sesuai” (tabel 6).

Penyampaianmotivasiolehpengawaspeneliti

masih dirasakan belum maksimal dan skor

yang diperoleh sebesar 5,0 atau “Cukup

Sesuai”denganRPP.

Setelah mengalami perbaikan pada

siklusIIkhususnyauntuktemuankekurangan

padaprosesbimbingansiklusI,padasiklusII

mengalami peningkatan. Rata-rata ke-

seluruhan pelaksanaan aspek Pendahuluan

secara kuantitatif maupun kualitatif me-

ngalami peningkatan yaitu dari 5,3 menjadi

8,0(tabel10)

Untuk aspekKegiatan Inti skor rata-

rataprosesbimbinganpada siklus I sebesar

6,6padakatagori “Cukup sesuai” (tabel10).

KondisiprosesbimbinganpadasikusIdengan

rata-rata skor tersebut disebabkan belum

Page 21: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

20 21

Mengajak kolabolator dalam membantu

menyiapkan pengamatan; 3) Melakukan

pengamatandanpenilaian

Tahapan-tahapan tindakan siklus II

sebagai berikut: 1) Pendahuluan Pengawas

peneliti menyampaikan tujuan pem-

bimbingan dan inti materi yang akan

diberikan. Penyampaian apersepsi, pe-

nyampaiantujuanbimbingan,danpemberian

motivasi; 2) Kegiatan Inti: a) Peneliti

menyampaikankonsepmaterisecaraumum

tentang pentingnya RPP kontekstual, b)

Penyampaian contoh RPP kontekstual dan

RPPbukanKontekstual,c)Pengawaspeneliti

memberikesempatanguruuntukbertanya,d)

Guru diminta melihat kembali �ile RPP

kontekstual untuk dikaji ulang sekaligus

sebagai referensi menyusun ulang RPP

kontekstual, e) Setiap guru diminta mem-

presentasikan hasil kerja penyusunan RPP

kontekstual,f)Setiapgurudimintamerespon

hasil setiapPersentasi,g)Pengawaspeneliti

mengulas setiap hasil prestasi setelah

interaksi antar guru, h) Pengawas peneliti

memberikan waktu untuk melakukan

kon�irmasi hasil ulang setelah Pengawas

peneliti mengulas hasil kerja guru, i)

Pengawas penelitimemberikan kesempatan

kepada guru untuk mengkon�irmasi hasil

kerjanya; 3) Penutup.a) Pengawas mene-

gaskankembali intimateridanmemberikan

kesimpulan hasil kerja guru; b) Pengawas

peneliti meminta guru mengumpulkan RPP

hasil tugas individu; c) Pengawas peneliti

melakukan re�leksi proses bimbingan

sebelummengakhirikegiatandandilanjutkan

dengan permintaan agar hasil kerja yang

Sudah baik untuk dikembangkan sehingga

menjadi lebih sempurna. Kegiatan diakhiri

denganucapansalam.

Pengamatan (observasi), Observasi

(pengamatan)selamapenelitianpadasiklusI

berlangsung dilakukan bersama oleh

pengawas penel i t i dan kolaborator.

Pengamatanyangdilakukansebagaiberikut:

1) Pengawas penelit i melaksanakan

pengamatan untuk guru selama mengikuti

bimbingan; 2) Kolaborator melakukan

pengamatan untuk guru dan pengawas

peneliti.HasilpengamatansiklusIIdisajikan

berturut-turut meliputi sebagai berikut: a)

Prosesbimbingan; b)Kegiatanguruselama

mengikuti bimbingan; c) Hasil kerja guru

menyusun RPP kontekstual meliputi

komponen yang ada pada RPP; d) Hasil

Pengamatan proses bimbingan. Setelah

pengamatan dilakukan oleh kolaborator

tentang penerapan rencana bimbingaan,

hasilnya sebagaimana pada tabel sebagai

berikut:

Tabel 8. Hasil Observasi penerapan RPPstrategiReadingGuidepadaprosesbimbinganSiklusII

No. Aspekkegiatan Skor Katagori

A Pendahuluan1.Penyampaianapersepsi 8 Sesuai2.Penyampaiantujuanbimbingan 8 Sesuai3.Pemberianmotivasi 8 SesuaiJumlah 24Rata-rata 8 Sesuai

B KegiatanInti1.Eksplorasia.Penelitimenyampaikankonsepmaterisecara

umumtentangpentingnyaRPPkontekstual

8 Sesuaib.PenyampaiancontohRPPkontekstualdan

bukanKontekstualdanmenjelaskanbedanya

7 CukupSesuaic.Pengawaspenelitimemberikesempatan

guru untukbertanya

9 Sesuaid.Gurudimintamelihatkembali�ileRPP

konteks-

tualuntukdikajiulangsekaligussebagaireferensi

menyusunulangRPPkontekstual

8 Sesuaie.Setiapgurudimintamempresentasikanhasil

kerjapenyusunanRPPkontekstual

8 SesuaiJumlah 40Rata-rata 8 Sesuai

2.Elaborasia.Setiapgurudimintameresponhasilsetiap

Persentasi

8 Sesuai

b.Pengawaspenelitimengulassetiaphasil

prestasisetelahinteraksiantarguru.

8 SesuaiJumlah 16Rata-rata 8 Sesuai

3.Kon�irmasi

a.Pengawaspenelitimemberikanwaktuuntuk

melakukankon�irmasihasilulangsetelah

Pengawaspenelitimengulashasilkerjaguru

8 Sesuaib.Pengawaspenelitimemberikankesempatankepa-

daguruuntukmengkon�irmasihasilkerjanya

8 SesuaiJumlah 16Rata-rata 8 SesuaiJumlahKegiatanInti 24Rata-rata 8 Sesuai

C Penutupa.Pengawasmenegaskankembaliintimateridanmemberikankesimpulanhasilkerjaguru 8 Sesuai

b.PengawaspenelitimemintagurumengumPulkanRPPhasiltugasindividu 8 Sesuai

c.Pengawaspenelitimelakukanre�leksiprosesbimbingansebelummengakhirikegiatandandilanjutkandenganpermintaanagarhasilkerjayang

Sudahbaikuntukdikembangkansehinggamenja-dilebihsempurna.Kegiatandiakhiridenganucapansalam.

8 Sesuai

Jumlah 24Rata-rata 8 SesuaiRata-ratakeseluruhan(A+B+C)/3 8 Sesuai

No. Aspekkegiatan Skor Katagori

a. KemampuanmenyusunRPPkontekstual

Setelah dilakukan penilaian atas hasil

pekerjaan setiap guru yakni berupa RPP

kontekstual, dan hasil tersebut dikaji dari

hasilrata-ratasetiapRPPkontekstualtampak

padatabelberikutini:

Tabel 9. Hasil kerja guru menyusun RPPkontekstualSiklusII

No NamaAsalSekolah

Matapelajaran

Nilai

PK

Rata-rata

Katagori

1 HAMSAR,S.Pd SDN001

Tematik

79.4

80.7 80.05SB

2 ERLINDA,S.Pd SDN004

Tematik

80.1

82.5 81.3SB

3 SUMARIYATI,S.Pd.SD SDN006 Tematik 80.3

82.3 81.3

SB

4 ELI,S.Pd SDN007

Tematik

81.9

83.3 82.6

SB

5ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

82.4

84.6 83.5SB

6 MARISAHUQIE SDN011 Tematik80.1 83.5 81.8

SB

Rata-rata 80.7 82.81

Sumber : RPP hasil pekerjaan guru.P : Pengawas; K : Kolaborator

a.Re�lekting(Re�lecting)

Sebagaimana pelaksanaan re�leksi

pada siklus I, pada siklus II bahwa yang

dilakukan berkenaan dengan proses

bimbingan dan hasil dari proses itu sendiri.

Berdasarkan asil temuan pada siklus II

terutama adanya kekurangan, maka temuan

tersebut akan dijadikan pertimbangan pada

penelitianyangakandatang.

Pembahasan

Sebelumpembahasanhasilpenelitian

dilakukan,terlebihdahuluakanmemaparkan

setiap aspek yang diobservasi dan data

tersebut dimasukkan/ diklasi�ikasi dalam

satu kolom. Tujuannya untuk memudahkan

melihatperkembanganprosesdanhasilsetiap

siklus.Selainituuntukmempermudahdalam

pengambilansimpulan.Tahapanpembahasan

akan disesuaikan dengan urutan masalah

penelitian yang telah dirumuskan, sebagai

berikut:

Penyajian data hasil pengamatan

proses bimbingan dalam bentuk skor rata-

rata.DatameliputidatasiklusIdanII,yaitu

sebagaiberikut:

Tabel 10. Skor rata-rata aspek pelaksanaanRKPsiklusIdanII

No. AspekkegiatanSiklusI SiklusII

Skor Katagori Skor KatagoriA Pendahuluan(Rata-rata)

5,3CukupSesuai

8,0Sesuai

B KegiatanInti

1.Eksplorasi(Rata-rata)

6,4

CukupSesuai

8,0

Sesuai

2.Elaborasi(Rata-rata)

6,5 CukupSesuai 8,0

Sesuai

3.Kon�irmasi(Rata-rata)

7,0

CukupSesuai

8,0Sesuai

C Penutup(Rata-rata)

7,0

CukupSesuai

8,0Sesuai

Jumlah 18,9 40,0Rata-ratakeseluruhan(A+B+C)/3

6,3CukupSesuai

8,0Sesuai

Ket:CS(CukupSesuai)

Memperhatikantabeldiatasdapatdipahami

bahwaprosesbimbingansiklusIpadaaspek

pendahuluan menunjukkan skor rata-rata

sebesar 5,3 atau dengan katagori “Cukup

sesuai”. Pada sub aspek ini masih terdapat

pelaksanaanyangkurangmaksimalyaitupada

penyampaian tujuan dengan skor 4,0 atau

dengan katagori “Kurang sesuai” (tabel 6).

Penyampaianmotivasiolehpengawaspeneliti

masih dirasakan belum maksimal dan skor

yang diperoleh sebesar 5,0 atau “Cukup

Sesuai”denganRPP.

Setelah mengalami perbaikan pada

siklusIIkhususnyauntuktemuankekurangan

padaprosesbimbingansiklusI,padasiklusII

mengalami peningkatan. Rata-rata ke-

seluruhan pelaksanaan aspek Pendahuluan

secara kuantitatif maupun kualitatif me-

ngalami peningkatan yaitu dari 5,3 menjadi

8,0(tabel10)

Untuk aspekKegiatan Inti skor rata-

rataprosesbimbinganpada siklus I sebesar

6,6padakatagori “Cukup sesuai” (tabel10).

KondisiprosesbimbinganpadasikusIdengan

rata-rata skor tersebut disebabkan belum

Page 22: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

22 23

maksimal dalam melaksanakan skenario

kegiatan inti. Hal ini ditandai dengan skor

rata-ratapadasubaspekeksplorasi,elaborasi

dan kon�irmasi masing-masing sebesar 6,4;

6,5; dan 7,0. Ketiga sub aspek ini secara

kualitatifmasukpadakatagori“Cukupsesuai”

(tabel10)

Sedang pada siklus II yakni setelah

dilakukan perbaikan, proses bimbingan

secara kuantitatif mengalami peningkatan

denganskor8,0(tabel8).Kondisi inisecara

kualitatifmengalamipeningkatandarisiklusI

ke siklus II dengan kategori “Sesuai”. Untuk

perolehan skor masing-masing sub aspek

siklus II yakni eksplorasi, elaborasi dan

kon�irmasi adalah 8,0; 8,0 dan 8,0. Secara

kualitatif untuk masing-masing sub aspek

padaposisi “Sesuai” denganRPP (tabel 10).

Jikamemperhatikan siklus I, untuk tiga sub

aspek tersebutsecarakuantitatifmengalami

peningkatan dengan kategori “Sesuai”.

Peningkatansecarakuantitatifuntuktigasub

aspek pada siklus II sudah sesuai dengan

harapan.Untuksubaspekeksplorasipoina,

setelah diberikanmasukan kolaborator dari

hasilpengamatanpadasiklusIadaperbaikan

yang signi�ikan. Hasil yang diperoleh

mengalami peningkatan baik secara

kuantitatifmaupunkualitatif yaitudari skor

6,4menjadi8,0.dari“Cukupsesuai”menjadi

“Sesuai.UntuksubaspekKegiatanintisecara

kuantitatifdankualitatifrata-ratamengalami

peningkatan.

Pada siklus I aspekpenutupmenun-

jukkanskorrata-ratasebesar7,0ataudengan

katagori “Cukup sesuai”. Pada sub aspek ini

masih terdapat pelaksanaan yang kurang

maksimal yaitu pada Pengawas peneliti

memberikan kesimpulan hasil kerja guru

denganskor5,0ataudengankatagori“Kurang

sesuai”(tabel6).

Setelah mengalami perbaikan pada

siklusIIkhususnyauntuktemuankekurangan

padaprosesbimbingansiklusI,padasiklusII

mengalami pengembangan. Rata-rata

keseluruhan pelaksanaan aspek Penutup

secara kuantitatif maupun kualitatif me-

ngalamipenguranganyaitudari7,66menjadi

7,33(tabel10)

Agar lebih memudahkan dalam

pembahasandansekaligusmemudahkanpula

dalammelihatperkembanganHasilkerjaguru

menyusun RPP kontekstual, maka hasil

penilaian pekerjaan guru yang meng-

gambarkanukuranHasilkerjagurumenyusun

RPP kontekstual,maka disajikan hasil skor

rata -rata kemampuan guru hasilre�leksi

awalsiklusIdanIIsebagaiberikut:

Tabel 11. Skor rata-rata nilai hasilkerja guru menyusun RPPkontekstualnilai awal, siklus Idan II

No NamaGuru AsalSekolahMata

pelajaranNilaiawal

SiklusI SiklusII

1 HAMSAR,S.Pd SDN001

Tematik

54.4

63.65 80.052 ERLINDA,S.Pd SDN004

Tematik

54.6

63.1 81.3

3 SUMARIYATI,S.Pd.SD SDN006 Tematik 59.6 63.65 81.34 ELI,S.Pd SDN007 Tematik 58 63.75 82.65 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

58.1

64.7 83.5

6 MARISAHUQIE SDN011

Tematik

58.9

64.6 81.8Jumlah - 343.6 383.45 490.55

Rata-rata - 57.27 63.90 81.76

Peningkatan hasil kerja pada setiap

gurusecarakuantitatifcukupmencolokpada

katagori “Baik”. Artinya secara kualitatif

peningkatan hasil kerja setiap guru dalam

menyusun RPP kontekstual masih pada

tingkatanmerata.

HasiltemuankekuranganpadasiklusI

oleh observer lebih lanjut dilakukan

perbaikanpada siklus II. PenerapanStrategi

Reading Guide pada siklus II menggunakan

metode tugas individu dengan mem-

perhatikan �ile portofolio RPP kontekstual

yang telah disediakan, ternyata kemampuan

guru dalam menyusun RPP megalami

peningkatan secara kuantitatif walaupun

secara kualitatif masih tetap. Kondisi ini

d i tun jukkan dengan skor ra ta -rata

keseluruhansetelahdiberikantindakansiklus

IImencapai71,93Angkaini lebihbesardari

siklus I sebesar 69,69 Keadaan ini bisa

dipahami bahwa setelah diberikan tindakan

siklus II ada peningkatan hasil kerja guru

dalam menyusun RPP kontekstual secara

kuantitatif.

SIMPULAN DAN SARAN

Simpulan

Hasilanalisisdatatentangpenerapan

strategiReadingGuidepadaprosesbimbingan

guruolehPengawaspeneliti,perolehanskor

ra ta -ra ta s t iap aspek perencanaan

pembimbinganpadaaspekpendahuluanpada

siklus I sebesar 7,33 pada katagori “Cukup

sesuai”. Sedangkan pada siklus II mencapai

skor 7,66 dengan katagori “cukup Sesuai”.

Untuk aspek kegiatan inti, skor rata-rata

keseluruhanpadasiklusIsebesar7,21dengan

katagori “Cukup sesuai” dan pada siklus II

perolehanskor7,1dengankatagori“Sesuai”.

Berikutnya pada kegiatan penutup, untuk

siklus I diperolehan skor rata-rata

keseluruhan sebesar 7,66 pada katagori

“Cukupsesuai”danpadasiklusIImenjadi7,33

dengankatagori“Sesuai”.Untukskorrata-rata

seluruhaspekpadasiklusIsebesar7,33dan

siklus II sebesar 7,22 dan keduanya

mengalamiperubahannilaikurangdancukup

kategori “Cukup sesuai” menjadi “Tetap

cukup”.Memperhatikan perkembangan skor

tersebut maka disimpulkan bahwa pe-

laksanaan bimbingan guru menyusun RPP

kontekstualSekolahbinaanPengawaspeneliti

semester ganjil tahun 2017-2018 di

Kecamatan Kundur Barat dengan meng-

gunakan strategi Reading Guide secara

kuantitatif dan kualitatif mengalami

peningkatan.

Hasilanalisisdatatentangpenerapan

strategiReadingGuidepadaprosesbimbingan

guruolehPengawaspeneliti,perolehanskor

rata-rata setiap aspek perencanaan

pembimbinganpadaaspekpendahuluanpada

siklus I sebesar 7,33 pada katagori “Cukup

sesuai”. Sedangkan pada siklus II mencapai

skor 7,66 dengan katagori “Sesuai”. Untuk

aspek kegiatan inti, skor rata-rata ke-

seluruhanpadasiklusIsebesar7,21dengan

katagori “Cukup sesuai” dan pada siklus II

perolehanskor7,1dengankatagori“Sesuai”.

Berikutnya pada kegiatan penutup, untuk

siklus I diperolehan skor rata-rata

keseluruhan sebesar 7,66 pada katagori

“Cukupsesuai”danpadasiklusIImenjadi7,32

dengan katagori “Sesuai”. Untuk skor rata-

rataseluruhaspekpadasiklusIsebesar7,32

dan siklus II sebesar 7,25 dan keduanya

mengalamiperubahanpadakatagori“Cukup

sesuai” menjadi “Sesuai”. Memperhatikan

perkembangan skor tersebut dapat

disimpulkan bahwa penerapan Strategi

ReadingGuidebaiksecarakuantitatifmaupun

kualitatifdapatmeningkatkanhasilkerjaguru

menyusunRPPkontekstualdiSekolahbinaan

Pengawas(Pengawaspeneliti)semesterganjil

tahun2017-2018diKecamatanKundurBarat.

Saran

Dengan pertimbangan hasil sim-

pulan di atas, beberapa saran yang dirasa

perludisampaikanyaitusebagaiberikut :1)

Bagi Lembaga, untuk lembaga agar

meningkatkan fasilitas bagi guru untuk

melakukan inovasi dalam menyusun

administrasi perangkat pembelajaran

khususnya da lam penyusunan RPP

kontekstual dengan harapan diikuti pada

pengembangandanpeningkatanprosesdan

Page 23: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

22 23

maksimal dalam melaksanakan skenario

kegiatan inti. Hal ini ditandai dengan skor

rata-ratapadasubaspekeksplorasi,elaborasi

dan kon�irmasi masing-masing sebesar 6,4;

6,5; dan 7,0. Ketiga sub aspek ini secara

kualitatifmasukpadakatagori“Cukupsesuai”

(tabel10)

Sedang pada siklus II yakni setelah

dilakukan perbaikan, proses bimbingan

secara kuantitatif mengalami peningkatan

denganskor8,0(tabel8).Kondisi inisecara

kualitatifmengalamipeningkatandarisiklusI

ke siklus II dengan kategori “Sesuai”. Untuk

perolehan skor masing-masing sub aspek

siklus II yakni eksplorasi, elaborasi dan

kon�irmasi adalah 8,0; 8,0 dan 8,0. Secara

kualitatif untuk masing-masing sub aspek

padaposisi “Sesuai” denganRPP (tabel 10).

Jikamemperhatikan siklus I, untuk tiga sub

aspek tersebutsecarakuantitatifmengalami

peningkatan dengan kategori “Sesuai”.

Peningkatansecarakuantitatifuntuktigasub

aspek pada siklus II sudah sesuai dengan

harapan.Untuksubaspekeksplorasipoina,

setelah diberikanmasukan kolaborator dari

hasilpengamatanpadasiklusIadaperbaikan

yang signi�ikan. Hasil yang diperoleh

mengalami peningkatan baik secara

kuantitatifmaupunkualitatif yaitudari skor

6,4menjadi8,0.dari“Cukupsesuai”menjadi

“Sesuai.UntuksubaspekKegiatanintisecara

kuantitatifdankualitatifrata-ratamengalami

peningkatan.

Pada siklus I aspekpenutupmenun-

jukkanskorrata-ratasebesar7,0ataudengan

katagori “Cukup sesuai”. Pada sub aspek ini

masih terdapat pelaksanaan yang kurang

maksimal yaitu pada Pengawas peneliti

memberikan kesimpulan hasil kerja guru

denganskor5,0ataudengankatagori“Kurang

sesuai”(tabel6).

Setelah mengalami perbaikan pada

siklusIIkhususnyauntuktemuankekurangan

padaprosesbimbingansiklusI,padasiklusII

mengalami pengembangan. Rata-rata

keseluruhan pelaksanaan aspek Penutup

secara kuantitatif maupun kualitatif me-

ngalamipenguranganyaitudari7,66menjadi

7,33(tabel10)

Agar lebih memudahkan dalam

pembahasandansekaligusmemudahkanpula

dalammelihatperkembanganHasilkerjaguru

menyusun RPP kontekstual, maka hasil

penilaian pekerjaan guru yang meng-

gambarkanukuranHasilkerjagurumenyusun

RPP kontekstual,maka disajikan hasil skor

rata -rata kemampuan guru hasilre�leksi

awalsiklusIdanIIsebagaiberikut:

Tabel 11. Skor rata-rata nilai hasilkerja guru menyusun RPPkontekstualnilai awal, siklus Idan II

No NamaGuru AsalSekolahMata

pelajaranNilaiawal

SiklusI SiklusII

1 HAMSAR,S.Pd SDN001

Tematik

54.4

63.65 80.052 ERLINDA,S.Pd SDN004

Tematik

54.6

63.1 81.3

3 SUMARIYATI,S.Pd.SD SDN006 Tematik 59.6 63.65 81.34 ELI,S.Pd SDN007 Tematik 58 63.75 82.65 ERNIMAYSITA,S.Pd.SD

SDN009

Tematik

58.1

64.7 83.5

6 MARISAHUQIE SDN011

Tematik

58.9

64.6 81.8Jumlah - 343.6 383.45 490.55

Rata-rata - 57.27 63.90 81.76

Peningkatan hasil kerja pada setiap

gurusecarakuantitatifcukupmencolokpada

katagori “Baik”. Artinya secara kualitatif

peningkatan hasil kerja setiap guru dalam

menyusun RPP kontekstual masih pada

tingkatanmerata.

HasiltemuankekuranganpadasiklusI

oleh observer lebih lanjut dilakukan

perbaikanpada siklus II. PenerapanStrategi

Reading Guide pada siklus II menggunakan

metode tugas individu dengan mem-

perhatikan �ile portofolio RPP kontekstual

yang telah disediakan, ternyata kemampuan

guru dalam menyusun RPP megalami

peningkatan secara kuantitatif walaupun

secara kualitatif masih tetap. Kondisi ini

d i tun jukkan dengan skor ra ta -rata

keseluruhansetelahdiberikantindakansiklus

IImencapai71,93Angkaini lebihbesardari

siklus I sebesar 69,69 Keadaan ini bisa

dipahami bahwa setelah diberikan tindakan

siklus II ada peningkatan hasil kerja guru

dalam menyusun RPP kontekstual secara

kuantitatif.

SIMPULAN DAN SARAN

Simpulan

Hasilanalisisdatatentangpenerapan

strategiReadingGuidepadaprosesbimbingan

guruolehPengawaspeneliti,perolehanskor

ra ta -ra ta s t iap aspek perencanaan

pembimbinganpadaaspekpendahuluanpada

siklus I sebesar 7,33 pada katagori “Cukup

sesuai”. Sedangkan pada siklus II mencapai

skor 7,66 dengan katagori “cukup Sesuai”.

Untuk aspek kegiatan inti, skor rata-rata

keseluruhanpadasiklusIsebesar7,21dengan

katagori “Cukup sesuai” dan pada siklus II

perolehanskor7,1dengankatagori“Sesuai”.

Berikutnya pada kegiatan penutup, untuk

siklus I diperolehan skor rata-rata

keseluruhan sebesar 7,66 pada katagori

“Cukupsesuai”danpadasiklusIImenjadi7,33

dengankatagori“Sesuai”.Untukskorrata-rata

seluruhaspekpadasiklusIsebesar7,33dan

siklus II sebesar 7,22 dan keduanya

mengalamiperubahannilaikurangdancukup

kategori “Cukup sesuai” menjadi “Tetap

cukup”.Memperhatikan perkembangan skor

tersebut maka disimpulkan bahwa pe-

laksanaan bimbingan guru menyusun RPP

kontekstualSekolahbinaanPengawaspeneliti

semester ganjil tahun 2017-2018 di

Kecamatan Kundur Barat dengan meng-

gunakan strategi Reading Guide secara

kuantitatif dan kualitatif mengalami

peningkatan.

Hasilanalisisdatatentangpenerapan

strategiReadingGuidepadaprosesbimbingan

guruolehPengawaspeneliti,perolehanskor

rata-rata setiap aspek perencanaan

pembimbinganpadaaspekpendahuluanpada

siklus I sebesar 7,33 pada katagori “Cukup

sesuai”. Sedangkan pada siklus II mencapai

skor 7,66 dengan katagori “Sesuai”. Untuk

aspek kegiatan inti, skor rata-rata ke-

seluruhanpadasiklusIsebesar7,21dengan

katagori “Cukup sesuai” dan pada siklus II

perolehanskor7,1dengankatagori“Sesuai”.

Berikutnya pada kegiatan penutup, untuk

siklus I diperolehan skor rata-rata

keseluruhan sebesar 7,66 pada katagori

“Cukupsesuai”danpadasiklusIImenjadi7,32

dengan katagori “Sesuai”. Untuk skor rata-

rataseluruhaspekpadasiklusIsebesar7,32

dan siklus II sebesar 7,25 dan keduanya

mengalamiperubahanpadakatagori“Cukup

sesuai” menjadi “Sesuai”. Memperhatikan

perkembangan skor tersebut dapat

disimpulkan bahwa penerapan Strategi

ReadingGuidebaiksecarakuantitatifmaupun

kualitatifdapatmeningkatkanhasilkerjaguru

menyusunRPPkontekstualdiSekolahbinaan

Pengawas(Pengawaspeneliti)semesterganjil

tahun2017-2018diKecamatanKundurBarat.

Saran

Dengan pertimbangan hasil sim-

pulan di atas, beberapa saran yang dirasa

perludisampaikanyaitusebagaiberikut :1)

Bagi Lembaga, untuk lembaga agar

meningkatkan fasilitas bagi guru untuk

melakukan inovasi dalam menyusun

administrasi perangkat pembelajaran

khususnya da lam penyusunan RPP

kontekstual dengan harapan diikuti pada

pengembangandanpeningkatanprosesdan

Page 24: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

24 25

hasilpembelajaranmelaluikegiatanPTSbagi

guru dan PTS bagi Kepala Sekolah; 2) Bagi

PengawasPeneliti,dalampelakasananproses

penelitian sampaimenghasilkan pencapaian

tujuan penelitian akan menjadi acuan bagi

Pengawas peneliti sebagai upaya pe-

ngembangan profesi dan sekaligus untuk

memberikanbantuangurudalammeningkat

dan mengembangkan admin i s t ra s i

perencanaanpembelajarankhususnyadalam

menyusun pengembangan perencanaan

pembelajaran; 3) Bagi Kepala Sekolah, hasil

Penelitian Tindakan Sekolah diharapkan

menjadi bahan masukan positip untuk

kegiatan inovasi profesi guru dan Kepala

Sekolah dalam kontek implementasi dan

pengembangan manajemen Sekolah secara

menyeluruh;4)Bagi Guru,melaluikegiatan

bimbingan dan hasil kerja yang diperoleh

guru dapat dipergunakan sebagai bahan

evaluasi profesi khususnya dalam pe-

nyusunan RPP kontekstual dengan mem-

perhatikan porto�ilo RPP kontekstual. Hasil

tersebut diharapkan diikuti dengan

pengembangandanpeningkatanpadaproses

danhasilpembelajaran.

DAFTARPUSTAKA

Akib,Zainal,2006.PenelitianTindakanKelas.Bandung:YramaWidya.

Dimyati,Dkk,1998,BelajardanPembelajaran,Jakarta,RinekaCipta.

Nasution, 1982,Metode Research, Bandung,Jemmars

Nurhadi, 2001, Pemotivasian Siswa UntukBelajar, Buku Ajar Mahasiswa,Surabaya; Universitas NegeriSurabaya.

PrayitnodanErmanAmti,2006,Dasar-DasarBimbingan dan Konseling, Jakarta,RinekaCipta.

Rusman, 2011, Model-Model PembelajaranMengembangkan ProfesionalismeGuru, Jakarta, PT. RajagGra�indoPersada.

Soekartawi, Dkk, 1995, MeningkaSDanR a n c a n g a n I n s t r u k s i o n a l(Instructional Design), Untukmemperbaiki Kualitas BelajarMengajar,Malang,Unibraw.

Trianto, 2008, Mendesain PembelajaranKontekstual , Jakarta, CerdasPustakaPublisher

Za in i , H isyam, dkk , 2008 , Strateg i

PembelajaranAktif, PustakaInsanMadani,Yogyakarta.

................, 2011, Penelitian Tindakan Matapelajaran, Pusat PengembanganTenaga Kependidikan BadanPengembangan Sumber DayaM a n u s i a P e n d i d i k a n d a nPenjaminan Mutu PendidikanKementerianPendidikanNasional,Jakarta.

. . . . . . . . . . . . . . . . , .h t t p : / / k i d i s p u rblogspot.com/2009/01/prinsip-pembelajaran-berbasis.Html

.

.................,()

..................,(http://mastarmudi.blogspot.co.id/2 0 1 0 / 0 7 / p e n g e r t i a n -observasi.html)

.................., Kementrian Pendidikan Nasional,PermendiknasNo.41tahun2007,Jakarta.

..................., 2011, Pendidikan Karakter,Direktorat Jendral PendidikanDasar,Jakarta

..................,1996, Kamus Besar BahasaIndonesia, P.N. BalaiPustaka, Jakarta

UPAYAMENINGKATKANKETERAMPILANMENULISCERITAPENDEKDENGANMETODEPEMBELAJARANPETAPIKIRAN(MINDMAPPING)PADASISWAKELASIX.6

SMPNEGERI1TANJUNGPINANGTAHUNPELAJARAN2015/2016

Darwis*

Abstrak:Tujuan penelitian ini adalah untuk mengetahuipeningkatan keterampilan menulis cerpendenganpenerapanmetodepetapikiran(mindmapping)padasiswakelasIX.6SMPNegeri1TanjungpinangTahunPelajaran2015/2016.PenelitianinimenggunakanpendekatanPenelitianTindakanKelas(ClassroomActionResearch),yaitupenelitianuntukmengatasipermasalahanyangadadalampembelajaran.Teknikpengumpulandatayangdigunakan adalah observasidantes.Data yangterkumpul dianalisis denganteknik analisis kritis berdasarkan indikator keberhasilan yang telah ditetapkan. Proses penelitiandilaksanakandalamtigasiklusdenganempattahappadatiapsiklusnya,yaitutahapperencanaan,tahappelaksanaan,tahapobservasi,sertatahapanalisisdanre�leksi.Hasilpenelitianinidapatdisimpulkanbahwa:(1)Penerapanmetodepembelajaranpetapikiran(mindmapping)dapatmeningkatkankeaktifan,perhatian,konsentrasi, minat serta motivasi siswa dalam pembelajaran menulis cerpen, (2) meningkatkanketerampilanmenuliscerpensiswa. Hal ini ditandai dengannilai rata-rata siswayangmengalamipeningkatansebelumtindakansampaipadatiapsiklusnya.Padakondisiawalnilairerata 61,88 dengantingkatketuntasanklasikal46,88%.PadasiklusI,nilairerata65,84dengantingkatketuntasanklasikal62,50%.PadasiklusII,nilairerata70,31dengantingkatketuntasanklasikal78,13%danpadasiklusIII,nilairerata73,81dengantingkatketuntasanklasikalmencapai93,75%.

KataKunci:MeningkatkanKeterampilanMenulisCerpen,MetodePembelajaranPetaPikiran

PENDAHULUAN

Pentingnya keterampilanmenulis ini

membuat orang perlu menguasai ke-

terampilanmenulis.Pernyataaninidikuatkan

oleh Morsey dalam Keke Taruli (2013:160),

yangmenyatakanbahwa“menulisdigunakan

olehorang-orang terpelajaruntukmencatat,

merekam, meyakinkan, melaporkan, atau

memberitahukan,danmemengaruhi”.Maksud

dan tujuan seperti itu hanya dapat dicapai

dengan baik oleh orang-orang yang dapat

menyusun pikiran dan menyatakan dengan

jelas.

Pembelajaran menulis cerita pendek

(cerpen) penting bagi siswa sekolah

menengah pertama, karena cerpen dapat

dijadikan sebagai sarana untuk berimajinasi

dan menuangkan p ik i ran . Menurut

Widyamartaya (2005:102) “menulis cerpen

ialahmenulis tentang sebuahperistiwa atau

kejadian pokok”. Berdasarkan pendapat

tersebut, dapat disimpulkan bahwa menulis

cerpen merupakan seni/keterampilan me-

nyajikanceritatentangsebuahperistiwaatau

kejadianpokokyangdapatdijadikansebagai

duniaalternatifpengarang.

Kemampuan menulis cerpen yang

dimilikisiswatidaklahsama.Sebagiansiswa

mampu menulis cerpen dengan baik dan

sebagiansiswayanglainmasihbelummampu

menulis cerpen dengan baik. Kondisi ini

diperburukdenganrendahnyaminatmenulis

siswa. Pendapat tersebut diperkuat oleh

pendapat Setyawan (2012:5), “bahwa

keterampilan menulis siswa masih rendah

ditandai dengan: (1) frekuensi kegiatan

menulis yang dilakukan oleh siswa sangat

rendah,(2)kualitaskaryatulissiswasangat

buruk, (3) rendahnya antusiasme dalam

mengikuti pembelajaran bahasa Indonesia

padaumumnya”.

Dari paparan tersebut dapat

diindikasikan bahwa pembelajaran

Page 25: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

24 25

hasilpembelajaranmelaluikegiatanPTSbagi

guru dan PTS bagi Kepala Sekolah; 2) Bagi

PengawasPeneliti,dalampelakasananproses

penelitian sampaimenghasilkan pencapaian

tujuan penelitian akan menjadi acuan bagi

Pengawas peneliti sebagai upaya pe-

ngembangan profesi dan sekaligus untuk

memberikanbantuangurudalammeningkat

dan mengembangkan admin i s t ra s i

perencanaanpembelajarankhususnyadalam

menyusun pengembangan perencanaan

pembelajaran; 3) Bagi Kepala Sekolah, hasil

Penelitian Tindakan Sekolah diharapkan

menjadi bahan masukan positip untuk

kegiatan inovasi profesi guru dan Kepala

Sekolah dalam kontek implementasi dan

pengembangan manajemen Sekolah secara

menyeluruh;4)Bagi Guru,melaluikegiatan

bimbingan dan hasil kerja yang diperoleh

guru dapat dipergunakan sebagai bahan

evaluasi profesi khususnya dalam pe-

nyusunan RPP kontekstual dengan mem-

perhatikan porto�ilo RPP kontekstual. Hasil

tersebut diharapkan diikuti dengan

pengembangandanpeningkatanpadaproses

danhasilpembelajaran.

DAFTARPUSTAKA

Akib,Zainal,2006.PenelitianTindakanKelas.Bandung:YramaWidya.

Dimyati,Dkk,1998,BelajardanPembelajaran,Jakarta,RinekaCipta.

Nasution, 1982,Metode Research, Bandung,Jemmars

Nurhadi, 2001, Pemotivasian Siswa UntukBelajar, Buku Ajar Mahasiswa,Surabaya; Universitas NegeriSurabaya.

PrayitnodanErmanAmti,2006,Dasar-DasarBimbingan dan Konseling, Jakarta,RinekaCipta.

Rusman, 2011, Model-Model PembelajaranMengembangkan ProfesionalismeGuru, Jakarta, PT. RajagGra�indoPersada.

Soekartawi, Dkk, 1995, MeningkaSDanR a n c a n g a n I n s t r u k s i o n a l(Instructional Design), Untukmemperbaiki Kualitas BelajarMengajar,Malang,Unibraw.

Trianto, 2008, Mendesain PembelajaranKontekstual , Jakarta, CerdasPustakaPublisher

Za in i , H isyam, dkk , 2008 , Strateg i

PembelajaranAktif, PustakaInsanMadani,Yogyakarta.

................, 2011, Penelitian Tindakan Matapelajaran, Pusat PengembanganTenaga Kependidikan BadanPengembangan Sumber DayaM a n u s i a P e n d i d i k a n d a nPenjaminan Mutu PendidikanKementerianPendidikanNasional,Jakarta.

. . . . . . . . . . . . . . . . , .h t t p : / / k i d i s p u rblogspot.com/2009/01/prinsip-pembelajaran-berbasis.Html

.

.................,()

..................,(http://mastarmudi.blogspot.co.id/2 0 1 0 / 0 7 / p e n g e r t i a n -observasi.html)

.................., Kementrian Pendidikan Nasional,PermendiknasNo.41tahun2007,Jakarta.

..................., 2011, Pendidikan Karakter,Direktorat Jendral PendidikanDasar,Jakarta

..................,1996, Kamus Besar BahasaIndonesia, P.N. BalaiPustaka, Jakarta

UPAYAMENINGKATKANKETERAMPILANMENULISCERITAPENDEKDENGANMETODEPEMBELAJARANPETAPIKIRAN(MINDMAPPING)PADASISWAKELASIX.6

SMPNEGERI1TANJUNGPINANGTAHUNPELAJARAN2015/2016

Darwis*

Abstrak:Tujuan penelitian ini adalah untuk mengetahuipeningkatan keterampilan menulis cerpendenganpenerapanmetodepetapikiran(mindmapping)padasiswakelasIX.6SMPNegeri1TanjungpinangTahunPelajaran2015/2016.PenelitianinimenggunakanpendekatanPenelitianTindakanKelas(ClassroomActionResearch),yaitupenelitianuntukmengatasipermasalahanyangadadalampembelajaran.Teknikpengumpulandatayangdigunakan adalah observasidantes.Data yangterkumpul dianalisis denganteknik analisis kritis berdasarkan indikator keberhasilan yang telah ditetapkan. Proses penelitiandilaksanakandalamtigasiklusdenganempattahappadatiapsiklusnya,yaitutahapperencanaan,tahappelaksanaan,tahapobservasi,sertatahapanalisisdanre�leksi.Hasilpenelitianinidapatdisimpulkanbahwa:(1)Penerapanmetodepembelajaranpetapikiran(mindmapping)dapatmeningkatkankeaktifan,perhatian,konsentrasi, minat serta motivasi siswa dalam pembelajaran menulis cerpen, (2) meningkatkanketerampilanmenuliscerpensiswa. Hal ini ditandai dengannilai rata-rata siswayangmengalamipeningkatansebelumtindakansampaipadatiapsiklusnya.Padakondisiawalnilairerata 61,88 dengantingkatketuntasanklasikal46,88%.PadasiklusI,nilairerata65,84dengantingkatketuntasanklasikal62,50%.PadasiklusII,nilairerata70,31dengantingkatketuntasanklasikal78,13%danpadasiklusIII,nilairerata73,81dengantingkatketuntasanklasikalmencapai93,75%.

KataKunci:MeningkatkanKeterampilanMenulisCerpen,MetodePembelajaranPetaPikiran

PENDAHULUAN

Pentingnya keterampilanmenulis ini

membuat orang perlu menguasai ke-

terampilanmenulis.Pernyataaninidikuatkan

oleh Morsey dalam Keke Taruli (2013:160),

yangmenyatakanbahwa“menulisdigunakan

olehorang-orang terpelajaruntukmencatat,

merekam, meyakinkan, melaporkan, atau

memberitahukan,danmemengaruhi”.Maksud

dan tujuan seperti itu hanya dapat dicapai

dengan baik oleh orang-orang yang dapat

menyusun pikiran dan menyatakan dengan

jelas.

Pembelajaran menulis cerita pendek

(cerpen) penting bagi siswa sekolah

menengah pertama, karena cerpen dapat

dijadikan sebagai sarana untuk berimajinasi

dan menuangkan p ik i ran . Menurut

Widyamartaya (2005:102) “menulis cerpen

ialahmenulis tentang sebuahperistiwa atau

kejadian pokok”. Berdasarkan pendapat

tersebut, dapat disimpulkan bahwa menulis

cerpen merupakan seni/keterampilan me-

nyajikanceritatentangsebuahperistiwaatau

kejadianpokokyangdapatdijadikansebagai

duniaalternatifpengarang.

Kemampuan menulis cerpen yang

dimilikisiswatidaklahsama.Sebagiansiswa

mampu menulis cerpen dengan baik dan

sebagiansiswayanglainmasihbelummampu

menulis cerpen dengan baik. Kondisi ini

diperburukdenganrendahnyaminatmenulis

siswa. Pendapat tersebut diperkuat oleh

pendapat Setyawan (2012:5), “bahwa

keterampilan menulis siswa masih rendah

ditandai dengan: (1) frekuensi kegiatan

menulis yang dilakukan oleh siswa sangat

rendah,(2)kualitaskaryatulissiswasangat

buruk, (3) rendahnya antusiasme dalam

mengikuti pembelajaran bahasa Indonesia

padaumumnya”.

Dari paparan tersebut dapat

diindikasikan bahwa pembelajaran

Page 26: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

26 27

menuliscerpen mengalami kegagalan. Hal

ini tentu sangat disayangkan karena

mengingat menulis cerpen merupakan

pembelajaransastrayangurgen.Sastraturut

memberikan kontribusi yang besar dalam

usaha pembinaan mental serta

memperkayakehidupanruhaniahmanusia.

Sastradapatmemberipengaruhyangbesar

terhadapcaraberpikirseseorangmengenai

hidup, mengenai baik dan buruk, mengenai

benardansalah,sertamengenaincarahidup

diri sendiri dan suatu bangsa. Sastra dapat

merangsang seseorang untuk lebih me-

mahami dan menghayati kehidupan. Sastra

bukan merumuskan dan mengabstraksikan

kehidupan,tetapimenampilkannya.Pendek

kata, pembelajaran sastra merupakan satu

kebutuhandalamrangkapembentukanmoral

bangsa.

Keterampilan menulis cerpen yang

diajarkan di sekolah-sekolah selama ini

menggunakan metode konvensional. Peran

guru amat dominan dalam proses pem-

belajaran. Siswa kurang aktif sehingga

menimbulkan kebosanan bagi siswa dalam

pembelajaranmenuliscerpensehinggakarya

yang dihasilkan siswa kurang maksimal.

Cerpen yang dibuatnya kurang menarik

karenabahasayangdigunakanmonoton,dan

pengembangan ide atau gagasan kurang

bervariasi. Hal ini dapat dilihat dari

kesesuaian isi cerpen dengan tema, pe-

ngembangan topik, dan diksi yang belum

mendapatperhatiandarisiswa.

Faktor lain yang menyebabkan

rendahnya keinginan siswa menulis cerpen

ialahmetode pembelajaran yang digunakan

dalam pembelajaranmenulis cerpen karena

selama ini guru hanya memberikan

penjelasan cara-cara menulis cerpen secara

teori tanpa adanya media yang digunakan

untuk mendukung serta menarik perhatian

siswa yang sebenarnya sangat penting

disuguhkan untukmeningkatkan kreativitas

dan daya imajinasi siswa dalam me-

ngungkapkan perasaan ide-ide yang se-

benarnya ada dalam potensi setiap siswa

hingga dapat memudahkan mereka untuk

berceritayangakandituangkanataudisajikan

dalam bentuk tulisan yang nantinya bisa

menjadi rangkaian kata-kata yang sangat

indahmeskirelatifpendek.

Untuk itu perlu adanya upaya untuk

mengatasikondisitersebut.Gurudiharapkan

dapat memi l ih metode yang l eb ih

menekankan pada pembelajaran langsung

yang lebih konkret, sehingga kemampuan

menulis siswa lebih meningkat. Guru dapat

menerapkan strategi-strategi pembelajaran

yang dapat memberikan peluang kepada

siswauntuk lebihaktif, kreatif,dan inovatif.

Strategitersebutdiharapkandapatmembuat

siswa mempunyai keyakinan bahwa dirinya

mampu belajar, yang dapat memanfaatkan

potensisiswaseluasluasnya.

Fenomena serupa terjadi dalam

pembelajaran menulispadasiswakelasIX.6

SMPNegeri1TanjungpinangTahunPelajaran

2015/2016.Pembelajaran menulis cerpen

masihdijejaliberbagaiteoritentangcerpen

dengankegiatanpraktikmenulisyangminim.

Yang mengakibatkan siswa tidak terlatih

untukberkreasimenuliscerpendenganbaik.

Lebih lanjut, keterampilan menulis siswa

tidak terkembangkan dengan baik. Hal ini

tercermindariperolehannilaimenuliscerpen

siswa. Dari 32 siswa, hanya 15 siswa yang

mencapai nilai di atas KKM (Kriteria

KetuntasanMinimal)yaitu65;sedangkan17

siswamasihmencapainilaidibawahKKM.Hal

iniberartihanya 48,22%ketuntasanbelajar

untuk kelas tersebut. Dari hasil pretes

menulis cerpen yang dilakukan diketahui

bahwasiswabanyakmelakukankesalahan

ejaan. Di samping itu, kebanyakan siswa

belummampumenampilkan ideceritayang

kreatifdansegar.Disampingitu,siswatidak

bisa mengorganisasikan tulisannya dengan

baik.Unsurintrinsikbelumtercakupdidalam

cerpen.Pemanfaatanpotensikatajugamasih

sangat kurang. Dijumpai pula konstruksi

kalimat yang salah sehingga mengaburkan

makna.

Untuk menyikapi permasalahan

tersebut diperlukan satu metode pem-

belajaranyangdapatmeningkatkankualitas

pembelajaran menulis cerpen. Diharapkan

dengan peningkatan kualitas proses

pembelajaran, hasil pembelajaran berupa

keterampilan menulis cerpen siswa pun

meningkat. Peta pikiran atau biasa dikenal

denganistilahmindmappingadalahmetode

yang tepat untukmengatasi permasalahan

tersebut.Berakardarikesulitansiswadalam

memahamidanmenerapkanunsur intrinsik

dalamcerpenyangdibuatnyasertakesulitan

dalammengembangkan ideceritadipilihlah

metodepetapikiran(mindmapping).Metode

yang dipopulerkan oleh Tony Buzan ini

merupakan metode yang efektif untuk

meningkatkanketerampilanmenulis.

Implikasi dari uraiandi atas dalam

kaitannyadenganpenelitianiniadalahperlu

diterapkannya metode pembelajaran peta

pikiran (mind mapping) sebagai upaya

meningkatkankemampuanmenuliscerpen,

dan memberi penelitian ini dengan judul

“UpayaMeningkatkanKeterampilanMenulis

CeritaPendekDenganMetodePembelajaran

PetaPikiran(MindMapping)PadaSiswaKelas

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran2015/2016”.

Berdasarpadalatarbelakangmasalah

yang dikemukakan dalam uraian di atas,

permasalahan dalam penel i t ian in i

dirumuskan sebagai berikut: Apakah

penerapanmetodepembelajaranpetapikiran

(mind mapping) dapat meningkatkan

keterampilanmenuliscerpensiswakelasIX.6

SMPNegeri1Tanjungpinang.

Penelitian ini bertujuan untuk me-

ningkatan keterampilan menulis cerpen

denganpenerapanmetodepembelajaranpeta

pikiran(mindmapping)padasiswakelasIX.6

SMPNegeri1Tanjungpinang.Adapunmanfaat

penelitian ini adalah: 1) Manfaat Teoritis

penelitian ini diharapkan dapat digunakan

untuk memperkaya khazanah i lmu

pengetahuanpembelajaransastrakhususnya

pada aspek metode alternatif pembelajaran

menulis cerpen; 2)Manfaat Praktis: a) Bagi

Siswa, (1) pembelajaran menulis cerpen

menjadi lebih bermakna, (2) melatih siswa

untuk berpikir imajinatif dan kreatif, (3)

meningkatkan keterampilan menulis cerpen

siswa;b)BagiGuru:(1)Meningkatkankinerja

guru, (2) Mendorong guru untuk me-

laksanakan pembelajaran yang inovatif

kreatif , (3) Mengatasi permasalahan

pembelajaran menulis cerpen yang dialami

oleh guru; c. Bagi Peneliti: (1) Mengem-

bangkanwawasan dan pengalaman peneliti,

(2)Pengaplikasianteoriyangtelahdiperoleh.

KAJIANTEORI

Kemampuan Menulis

Kemampuan menulis adalah ke-

mampuan orang memakai bahasa tulis

sebagai wadah, alat, dan media untuk

memaparkan isi jiwa serta pengalaman.

Tingkah laku yang merupakan indikasi

kemampuan ini berupa: 1) kemampuan

memilih ide, 2) kemampuan menata atau

mengorganisasikan ide pilihan secara

Page 27: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

26 27

menuliscerpen mengalami kegagalan. Hal

ini tentu sangat disayangkan karena

mengingat menulis cerpen merupakan

pembelajaransastrayangurgen.Sastraturut

memberikan kontribusi yang besar dalam

usaha pembinaan mental serta

memperkayakehidupanruhaniahmanusia.

Sastradapatmemberipengaruhyangbesar

terhadapcaraberpikirseseorangmengenai

hidup, mengenai baik dan buruk, mengenai

benardansalah,sertamengenaincarahidup

diri sendiri dan suatu bangsa. Sastra dapat

merangsang seseorang untuk lebih me-

mahami dan menghayati kehidupan. Sastra

bukan merumuskan dan mengabstraksikan

kehidupan,tetapimenampilkannya.Pendek

kata, pembelajaran sastra merupakan satu

kebutuhandalamrangkapembentukanmoral

bangsa.

Keterampilan menulis cerpen yang

diajarkan di sekolah-sekolah selama ini

menggunakan metode konvensional. Peran

guru amat dominan dalam proses pem-

belajaran. Siswa kurang aktif sehingga

menimbulkan kebosanan bagi siswa dalam

pembelajaranmenuliscerpensehinggakarya

yang dihasilkan siswa kurang maksimal.

Cerpen yang dibuatnya kurang menarik

karenabahasayangdigunakanmonoton,dan

pengembangan ide atau gagasan kurang

bervariasi. Hal ini dapat dilihat dari

kesesuaian isi cerpen dengan tema, pe-

ngembangan topik, dan diksi yang belum

mendapatperhatiandarisiswa.

Faktor lain yang menyebabkan

rendahnya keinginan siswa menulis cerpen

ialahmetode pembelajaran yang digunakan

dalam pembelajaranmenulis cerpen karena

selama ini guru hanya memberikan

penjelasan cara-cara menulis cerpen secara

teori tanpa adanya media yang digunakan

untuk mendukung serta menarik perhatian

siswa yang sebenarnya sangat penting

disuguhkan untukmeningkatkan kreativitas

dan daya imajinasi siswa dalam me-

ngungkapkan perasaan ide-ide yang se-

benarnya ada dalam potensi setiap siswa

hingga dapat memudahkan mereka untuk

berceritayangakandituangkanataudisajikan

dalam bentuk tulisan yang nantinya bisa

menjadi rangkaian kata-kata yang sangat

indahmeskirelatifpendek.

Untuk itu perlu adanya upaya untuk

mengatasikondisitersebut.Gurudiharapkan

dapat memi l ih metode yang l eb ih

menekankan pada pembelajaran langsung

yang lebih konkret, sehingga kemampuan

menulis siswa lebih meningkat. Guru dapat

menerapkan strategi-strategi pembelajaran

yang dapat memberikan peluang kepada

siswauntuk lebihaktif, kreatif,dan inovatif.

Strategitersebutdiharapkandapatmembuat

siswa mempunyai keyakinan bahwa dirinya

mampu belajar, yang dapat memanfaatkan

potensisiswaseluasluasnya.

Fenomena serupa terjadi dalam

pembelajaran menulispadasiswakelasIX.6

SMPNegeri1TanjungpinangTahunPelajaran

2015/2016.Pembelajaran menulis cerpen

masihdijejaliberbagaiteoritentangcerpen

dengankegiatanpraktikmenulisyangminim.

Yang mengakibatkan siswa tidak terlatih

untukberkreasimenuliscerpendenganbaik.

Lebih lanjut, keterampilan menulis siswa

tidak terkembangkan dengan baik. Hal ini

tercermindariperolehannilaimenuliscerpen

siswa. Dari 32 siswa, hanya 15 siswa yang

mencapai nilai di atas KKM (Kriteria

KetuntasanMinimal)yaitu65;sedangkan17

siswamasihmencapainilaidibawahKKM.Hal

iniberartihanya 48,22%ketuntasanbelajar

untuk kelas tersebut. Dari hasil pretes

menulis cerpen yang dilakukan diketahui

bahwasiswabanyakmelakukankesalahan

ejaan. Di samping itu, kebanyakan siswa

belummampumenampilkan ideceritayang

kreatifdansegar.Disampingitu,siswatidak

bisa mengorganisasikan tulisannya dengan

baik.Unsurintrinsikbelumtercakupdidalam

cerpen.Pemanfaatanpotensikatajugamasih

sangat kurang. Dijumpai pula konstruksi

kalimat yang salah sehingga mengaburkan

makna.

Untuk menyikapi permasalahan

tersebut diperlukan satu metode pem-

belajaranyangdapatmeningkatkankualitas

pembelajaran menulis cerpen. Diharapkan

dengan peningkatan kualitas proses

pembelajaran, hasil pembelajaran berupa

keterampilan menulis cerpen siswa pun

meningkat. Peta pikiran atau biasa dikenal

denganistilahmindmappingadalahmetode

yang tepat untukmengatasi permasalahan

tersebut.Berakardarikesulitansiswadalam

memahamidanmenerapkanunsur intrinsik

dalamcerpenyangdibuatnyasertakesulitan

dalammengembangkan ideceritadipilihlah

metodepetapikiran(mindmapping).Metode

yang dipopulerkan oleh Tony Buzan ini

merupakan metode yang efektif untuk

meningkatkanketerampilanmenulis.

Implikasi dari uraiandi atas dalam

kaitannyadenganpenelitianiniadalahperlu

diterapkannya metode pembelajaran peta

pikiran (mind mapping) sebagai upaya

meningkatkankemampuanmenuliscerpen,

dan memberi penelitian ini dengan judul

“UpayaMeningkatkanKeterampilanMenulis

CeritaPendekDenganMetodePembelajaran

PetaPikiran(MindMapping)PadaSiswaKelas

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran2015/2016”.

Berdasarpadalatarbelakangmasalah

yang dikemukakan dalam uraian di atas,

permasalahan dalam penel i t ian in i

dirumuskan sebagai berikut: Apakah

penerapanmetodepembelajaranpetapikiran

(mind mapping) dapat meningkatkan

keterampilanmenuliscerpensiswakelasIX.6

SMPNegeri1Tanjungpinang.

Penelitian ini bertujuan untuk me-

ningkatan keterampilan menulis cerpen

denganpenerapanmetodepembelajaranpeta

pikiran(mindmapping)padasiswakelasIX.6

SMPNegeri1Tanjungpinang.Adapunmanfaat

penelitian ini adalah: 1) Manfaat Teoritis

penelitian ini diharapkan dapat digunakan

untuk memperkaya khazanah i lmu

pengetahuanpembelajaransastrakhususnya

pada aspek metode alternatif pembelajaran

menulis cerpen; 2)Manfaat Praktis: a) Bagi

Siswa, (1) pembelajaran menulis cerpen

menjadi lebih bermakna, (2) melatih siswa

untuk berpikir imajinatif dan kreatif, (3)

meningkatkan keterampilan menulis cerpen

siswa;b)BagiGuru:(1)Meningkatkankinerja

guru, (2) Mendorong guru untuk me-

laksanakan pembelajaran yang inovatif

kreatif , (3) Mengatasi permasalahan

pembelajaran menulis cerpen yang dialami

oleh guru; c. Bagi Peneliti: (1) Mengem-

bangkanwawasan dan pengalaman peneliti,

(2)Pengaplikasianteoriyangtelahdiperoleh.

KAJIANTEORI

Kemampuan Menulis

Kemampuan menulis adalah ke-

mampuan orang memakai bahasa tulis

sebagai wadah, alat, dan media untuk

memaparkan isi jiwa serta pengalaman.

Tingkah laku yang merupakan indikasi

kemampuan ini berupa: 1) kemampuan

memilih ide, 2) kemampuan menata atau

mengorganisasikan ide pilihan secara

Page 28: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

28 29

sistematis, 3) kemampuan menggunakan

bahasa menurut kaidah kaidah serta

kebiasaan-kebiasaan pemakai bahasa yang

telahumumsifatnya,4)kemampuanmemilih

danmenggunakankosakata,ungkapan,dan

istilah yang tepat dan menarik, dan 5)

kemampuan menerapkan kaidah penulisan

atauejaansecaratepat.

Seperti halnya dengan kemampuan

membaca, kemampuan menulis ini pun

bukanlahkemampuanyangdapatdiwariskan,

tetapihasilprosesbelajardanberlatih.Oleh

sebab itu,keadaandankualitaskemampuan

menulis setiap orang tidak sama. Media

edukatif formal yang selama ini disepakati

sebagaimediakonvensionaluntukmembina

kemampuan menulis adalah pengajaran

menulis atau mengarang merupakan salah

satu bagian dari pengajaran bahasa.

Pembinaan kemampuan ini dilaksanakan

menurut ketentuan ketentuan yang sudah

diatur oleh program yang tercantum dalam

kurikulumdan jugaoleh akti�itas guruyang

bersangkutan. Kemampuan menulis siswa

sebagai out-put pengajaran menulis dapat

diukur, baik secara langsung maupun tidak

langsung. Sasaranyangdiukur ialah isi, tata

bahasa,gaya,danpenulisankaryasiswaitu.

PengertianCerpen

MenurutHeruKurniawandanSutardi

(2012:59): “Cerpen adalah rangkaian

peristiwa yang terjalin menjadi satu yang

didalamnya terjadi kon�lik antar tokoh atau

dalamdiri tokoh itusendiridalam latardan

alur”. Peristiwa dalam cerita berwujud

hubungan antar tokoh, tempat, dan waktu

yang membentuk satu kesatuan sama

hakikatnyadengankehidupannyata, sebuah

peristiwa terjadi karena kesatuan manusia,

tempat, dan waktu. Dari kesatuan itulah

perist iwa terbentuk . Cerpen sela lu

menampilkan diri yang demikian. Bedanya,

perist iwa dalam kenyataan bersifat

persepsional-komunal, sedangkan peristiwa

dalam cerita bersifat imajinasi individual.

Dalam cerpen, peristiwa dideskripsikan

dengankata-katasebagaiperasaanimajinasi

pengarang terhadap suatu peristiwa yang

dibayangkannya.

Jika puisi kekuatan utamanya pada

diksi,kalimat,dantipogra�imakapadacerita

terdapatpadadeskripsiperistiwayangbaik,

yang merupakan perpaduan antara tokoh,

latar, dan alur. Rangkaian peristiwa itulah

yang kemudian membentuk genre cerpen

sehingga baik-buruknya suatu cerpen

d i t e n t u kan p ad a p en g gamba r - a n -

penggambaranperistiwayangdilukiskanoleh

pengarangnya.

Menurut Antilan Purba (2012:51),

“menulisceritapendekmerupakanseniyang

sulit”.Ceritapendekmembutuhkankepekaan

penulisnya untuk bersifat ekonomi dan

pemilih dalam segala hal. Oleh karena itu,

tidakbolehadaunsuryangterbuangpercuma

dalam cerita pendek”. Cerita pendek adalah

ceritayangmembatasidiridalammembahas

salah satu unsur �iksi dalam aspeknya yang

terkecil. Kependekan sebuah cerita pendek

bukan karena bentuknya yang jauh lebih

pendek dari novel, melainkan karena aspek

masalahnya yang sangat dibataasi. Dengan

pembatasan ini, sebuah masalah akan

tergambarkanjauhlebihjelasdanjauhlebih

mengesankanbagipembaca.

Kesanyangditinggalkanolehsebuah

ceritapendekharustajamdandalamsehingga

sekalimembacanyakitatakakanpernahlupa.

Kalausebuahceritapendekmenggambarkan

watak pelit seorang tokoh, misalnya

pengarang harus menceritakan secara

ringkas,cermatmemilihadeganyangsangat

penting saja, sehingga sifat kepelitan itu

munculdenganjelas,jernih,dantajam.Sebab

itu, sifat seleksi sangatpentingdalamcerita

pendek.Segalasesuatuharusdiseleksisecara

cermat sehingga titik yang dituju cerita

pendekmenjaditerfokusbenar.

KemampuanMenulisCeritaPendek

Trianto (2011 158-159), “Ke-

mampuan menulis cerita pendek adalah

kesanggupan atau kecakapan seseorang

menggunakan ide, pikiran, pengetahuan,

ilmu,danpengalaman-pengalamanhidupnya

dalam bahasa tulis yang jelas, runtut,

ekspresif, enak dibaca, dan bisa dipahami

orang lain”. Dalam menulis cerita pendek,

penulis dituntut untuk mengkreasikan

karangannya dengan tetap memperhatikan

struktur cerita pendek, kemenarikan, dan

keunikandarisebuahceritapendek.

Dari kemampuan menulis cerita

pendek diharapkan siswa memiliki kom-

petensi untuk menyusun karangan dan

menulisprosa sederhana. Setelahmengikuti

pembelajaran tersebut siswa diharapkan

mampumenyebutkanbeberapapengalaman

yang menarik (menyenangkan, tidak me-

nyenangkan,mengharukan,dansebagainya),

memilihsalahsatu,danmerincisegi-segiyang

hendak diuraikan tentang satu pengalaman

itu, menyusun kerangka cerita, dan me-

ngembangkan kerangka cerita pengalaman

menjadi cerita yang utuhdanpadu.Dengan

prosa sederhana inilah yang bisa di-

kembangkanmenjadi bentuk cerita lainnya,

salahsatunyaceritapendek.

Dengandemikian,dapatdisimpulkan

bahwa kemampuan menulis cerita pendek

adalahkesanggupanataukemampuanuntuk

melahirkan pikiran dan perasaan dengan

tulisan berbetuk �iksi (cerpen), yang di

dalamnyaterdapatunsur-unsurtema,tokoh,

alur, latar, amanat, sudut pandang dan gaya

bahasa yang disampaikan kepada pembaca,

yangdisajikandenganbahasayangmenarik

dansugestif.

MetodePembelajaranMindMapping

Ahamad Munjin (2009,110-111),

“Pengertian Metode Mind Mapping (Peta

Pikiran)MetodeMindMapping(PetaPikiran)

adalah metode pembelajaran yang di-

kembangkanolehTonyBuzana,kepalaBrain

Foundation. Peta pikiran adalah metode

mencatat kreatif yang memudahkan kita

mengingatbanyakinformasi”.Setelahselesai,

catatanyangdibuatmembentuksebuahpola

gagasanyangsalingberkaitan,dengantopik

utama di tengah, sementara subtopik dan

perincian menjadi cabang-cabangnya.

Cabang-cabang tersebut juga bisa ber-

kembang lagi sampai ke materi yang lebih

kecil. Sebagaimana struktur keturunan

manusiayangbisaberkembangterussampai

hariakhirtiba,sehinggaterbentuklahsebuah

sistemketurunanmanusiahidupsampaihari

akhir.

Belajar berbasis pada konsep Peta

Pikiran (Mind Mapping) merupakan cara

be la jar yang menggunakan konsep

pembelajaran komprehensif Total Mind

Learning (TML). Pada konteks TML,

pembelajaran mendapatkan arti yang lebih

luas.Bahwasanya,disetiapsaatdandisetiap

tempatsemuamakhlukhidupdimukabumi

belajar, karena belajar merupakan proses

alamiah. Semuamakhluk belajar menyikapi

berbagai stimulus dari lingkungan sekitar

untukmempertahankanhidup.

Ahamad Munjin (2009:111), juga

berpendapat“Petapikiranmenirukanproses

Page 29: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

28 29

sistematis, 3) kemampuan menggunakan

bahasa menurut kaidah kaidah serta

kebiasaan-kebiasaan pemakai bahasa yang

telahumumsifatnya,4)kemampuanmemilih

danmenggunakankosakata,ungkapan,dan

istilah yang tepat dan menarik, dan 5)

kemampuan menerapkan kaidah penulisan

atauejaansecaratepat.

Seperti halnya dengan kemampuan

membaca, kemampuan menulis ini pun

bukanlahkemampuanyangdapatdiwariskan,

tetapihasilprosesbelajardanberlatih.Oleh

sebab itu,keadaandankualitaskemampuan

menulis setiap orang tidak sama. Media

edukatif formal yang selama ini disepakati

sebagaimediakonvensionaluntukmembina

kemampuan menulis adalah pengajaran

menulis atau mengarang merupakan salah

satu bagian dari pengajaran bahasa.

Pembinaan kemampuan ini dilaksanakan

menurut ketentuan ketentuan yang sudah

diatur oleh program yang tercantum dalam

kurikulumdan jugaoleh akti�itas guruyang

bersangkutan. Kemampuan menulis siswa

sebagai out-put pengajaran menulis dapat

diukur, baik secara langsung maupun tidak

langsung. Sasaranyangdiukur ialah isi, tata

bahasa,gaya,danpenulisankaryasiswaitu.

PengertianCerpen

MenurutHeruKurniawandanSutardi

(2012:59): “Cerpen adalah rangkaian

peristiwa yang terjalin menjadi satu yang

didalamnya terjadi kon�lik antar tokoh atau

dalamdiri tokoh itusendiridalam latardan

alur”. Peristiwa dalam cerita berwujud

hubungan antar tokoh, tempat, dan waktu

yang membentuk satu kesatuan sama

hakikatnyadengankehidupannyata, sebuah

peristiwa terjadi karena kesatuan manusia,

tempat, dan waktu. Dari kesatuan itulah

perist iwa terbentuk . Cerpen sela lu

menampilkan diri yang demikian. Bedanya,

perist iwa dalam kenyataan bersifat

persepsional-komunal, sedangkan peristiwa

dalam cerita bersifat imajinasi individual.

Dalam cerpen, peristiwa dideskripsikan

dengankata-katasebagaiperasaanimajinasi

pengarang terhadap suatu peristiwa yang

dibayangkannya.

Jika puisi kekuatan utamanya pada

diksi,kalimat,dantipogra�imakapadacerita

terdapatpadadeskripsiperistiwayangbaik,

yang merupakan perpaduan antara tokoh,

latar, dan alur. Rangkaian peristiwa itulah

yang kemudian membentuk genre cerpen

sehingga baik-buruknya suatu cerpen

d i t e n t u kan p ad a p en g gamba r - a n -

penggambaranperistiwayangdilukiskanoleh

pengarangnya.

Menurut Antilan Purba (2012:51),

“menulisceritapendekmerupakanseniyang

sulit”.Ceritapendekmembutuhkankepekaan

penulisnya untuk bersifat ekonomi dan

pemilih dalam segala hal. Oleh karena itu,

tidakbolehadaunsuryangterbuangpercuma

dalam cerita pendek”. Cerita pendek adalah

ceritayangmembatasidiridalammembahas

salah satu unsur �iksi dalam aspeknya yang

terkecil. Kependekan sebuah cerita pendek

bukan karena bentuknya yang jauh lebih

pendek dari novel, melainkan karena aspek

masalahnya yang sangat dibataasi. Dengan

pembatasan ini, sebuah masalah akan

tergambarkanjauhlebihjelasdanjauhlebih

mengesankanbagipembaca.

Kesanyangditinggalkanolehsebuah

ceritapendekharustajamdandalamsehingga

sekalimembacanyakitatakakanpernahlupa.

Kalausebuahceritapendekmenggambarkan

watak pelit seorang tokoh, misalnya

pengarang harus menceritakan secara

ringkas,cermatmemilihadeganyangsangat

penting saja, sehingga sifat kepelitan itu

munculdenganjelas,jernih,dantajam.Sebab

itu, sifat seleksi sangatpentingdalamcerita

pendek.Segalasesuatuharusdiseleksisecara

cermat sehingga titik yang dituju cerita

pendekmenjaditerfokusbenar.

KemampuanMenulisCeritaPendek

Trianto (2011 158-159), “Ke-

mampuan menulis cerita pendek adalah

kesanggupan atau kecakapan seseorang

menggunakan ide, pikiran, pengetahuan,

ilmu,danpengalaman-pengalamanhidupnya

dalam bahasa tulis yang jelas, runtut,

ekspresif, enak dibaca, dan bisa dipahami

orang lain”. Dalam menulis cerita pendek,

penulis dituntut untuk mengkreasikan

karangannya dengan tetap memperhatikan

struktur cerita pendek, kemenarikan, dan

keunikandarisebuahceritapendek.

Dari kemampuan menulis cerita

pendek diharapkan siswa memiliki kom-

petensi untuk menyusun karangan dan

menulisprosa sederhana. Setelahmengikuti

pembelajaran tersebut siswa diharapkan

mampumenyebutkanbeberapapengalaman

yang menarik (menyenangkan, tidak me-

nyenangkan,mengharukan,dansebagainya),

memilihsalahsatu,danmerincisegi-segiyang

hendak diuraikan tentang satu pengalaman

itu, menyusun kerangka cerita, dan me-

ngembangkan kerangka cerita pengalaman

menjadi cerita yang utuhdanpadu.Dengan

prosa sederhana inilah yang bisa di-

kembangkanmenjadi bentuk cerita lainnya,

salahsatunyaceritapendek.

Dengandemikian,dapatdisimpulkan

bahwa kemampuan menulis cerita pendek

adalahkesanggupanataukemampuanuntuk

melahirkan pikiran dan perasaan dengan

tulisan berbetuk �iksi (cerpen), yang di

dalamnyaterdapatunsur-unsurtema,tokoh,

alur, latar, amanat, sudut pandang dan gaya

bahasa yang disampaikan kepada pembaca,

yangdisajikandenganbahasayangmenarik

dansugestif.

MetodePembelajaranMindMapping

Ahamad Munjin (2009,110-111),

“Pengertian Metode Mind Mapping (Peta

Pikiran)MetodeMindMapping(PetaPikiran)

adalah metode pembelajaran yang di-

kembangkanolehTonyBuzana,kepalaBrain

Foundation. Peta pikiran adalah metode

mencatat kreatif yang memudahkan kita

mengingatbanyakinformasi”.Setelahselesai,

catatanyangdibuatmembentuksebuahpola

gagasanyangsalingberkaitan,dengantopik

utama di tengah, sementara subtopik dan

perincian menjadi cabang-cabangnya.

Cabang-cabang tersebut juga bisa ber-

kembang lagi sampai ke materi yang lebih

kecil. Sebagaimana struktur keturunan

manusiayangbisaberkembangterussampai

hariakhirtiba,sehinggaterbentuklahsebuah

sistemketurunanmanusiahidupsampaihari

akhir.

Belajar berbasis pada konsep Peta

Pikiran (Mind Mapping) merupakan cara

be la jar yang menggunakan konsep

pembelajaran komprehensif Total Mind

Learning (TML). Pada konteks TML,

pembelajaran mendapatkan arti yang lebih

luas.Bahwasanya,disetiapsaatdandisetiap

tempatsemuamakhlukhidupdimukabumi

belajar, karena belajar merupakan proses

alamiah. Semuamakhluk belajar menyikapi

berbagai stimulus dari lingkungan sekitar

untukmempertahankanhidup.

Ahamad Munjin (2009:111), juga

berpendapat“Petapikiranmenirukanproses

Page 30: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

30 31

ber�ikir ini, memungkinkan individu

berpindah-pindah topik”. Individu merekam

informasi melalui simbol, gambar, arti

emosional, danwarna”.Mekanisme ini sama

persisdengancaraotakmemperosesberbagai

informasi yang masuk. Dan karena peta

pikiran melibatkan kedua belah otak, anda

dapat mengingat informasi dengan lebih

mudah.

TeknikMindMapingmenuntutsiswa

untuk menguasai bagian demi bagian dari

bahan yang diajarkan kemudian bertukar

pikiran dengan siswa lain dan saling

mengajari satu sama lain. Selain itu, siswa

bekerjadengansesamasiswadalamsuasana

gotong royong dan mempunyai banyak

kesempatan untuk mengolah informasi dan

meningkatkankemampuanberkomunikasi.

KerangkaBerpikir

Berdasar pada permasalahan yang

ada, dipilihlah metode peta pikiran (mind

mapping)untukmengatasipermasalahan

tersebut. Metode ini dipilih untuk

melakukan pencatatan secara ringkas dan

sistematis serta dapat mengembangkan

gagasan karena rangsang visual berupa

gambar serta warna yang ditawarkan. Di

samping itu,metode ini diharapkanmampu

mengoptimalkan fungsi kerja otak kanan

sehingga dapat membangkitkan kreativitas

danimajinasiyangsangatdiperlukandalam

kegiatanmenulisceritapendek.Siswadapat

mengembangkan idedaripetapikiranyang

telahdibuatsehinggatidaklagikehabisanide.

Hal ini akan lebih mengefekti�kan waktu

pembelajaran.

Daripenerapanmetodepetapikran

tersebutdiharapkanterjadipeningkatanbaik

pada kualitas proses pembelajaran yang

ditandai dengan peningkatan keaktifan,

perhatian,konsentrasi,minat,danmotivasi

siswaterhadappembelajaranmenuliscerita

pendek,maupunketerampilanmenuliscerita

pendek yang ditandai dengan peningkatan

kreativitas, imajinasi, pengorganisasian

paragraf, pemanfaatan potensi kata,

pengembanganbahasa,mekanikpadacerpen

karangansiswadanketuntasanbelajar.

Hipotesis Tindakan

Berdasarkan kajian teori dan

kerangka berpikir di atas, dapat diajukan

hipotesisdalampenelitiantindakankelasini

sebagai berikut: Dengan menggunakan

metode peta pikiran (mindmapping) dalam

pembelajaran Bahasa Indonesia, khususnya

menulis cerita pendek, hasil keterampilan

menulisceritapendeksiswakelas X.6SMP

Negeri 1 Tanjungpinang Tahun Pelajaran

2015/2016.

METODOLOGI PENELITIAN

Jenis Penelitian

Penelitian ini berjenis Penelitian

TindakanKelas (ClassroomActionResearch).

Penelitian ini bertujuan untuk mengetahui

ada tidaknya peningkatan keterampilan

menulis cerpen siswa dengan penerapan

metode pembelajaran peta pikiran (mind

mapping). Strategi yang digunakan dalam

penelitian ini adalah deskriptif kualitatif.

Strategi ini bertujuan untuk meng-

gambarkan serta menjelaskan kenyataan

di lapangan. Kenyataan yang dimaksud

adalahprosespembelajaranmenuliscerpen

sebelumdansesudahdiberitindakanberupa

penerapanmetodepembelajaranpetapikiran

(mindmapping).

SubjekdanObjekPenelitian

Subjek penelitian adalah siswa kelas

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran 2015/2016 yang berjumlah 32

siswa.Sedangkanobjekpenelitianmencakup

proses pembelajaran menulis cerpen dan

penilaianketerampilanmenuliscerpensiswa

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran 2015/2016 melalui penerapan

metode pembelajaran peta pikiran (mind

mapping).

Teknik Pengumpulan Data

Data-data dalam penelitian ini

dikumpulkandengantekniksebagaiberikut:

1) Observasi, dilakukan untuk mengetahui

peningkatanpembelajaranyangdicapaioleh

siswa. Teknik ini dilakukan sejak sebelum

tindakandiberikan,saattindakandiberikan

hingga akhir tindakan; 2) Tes menulis

cerpen, tes ini dilakukan untuk mengukur

kemampuan bercerita siswa sebelum dan

sesudah dikenai tindakan. Adapun aspek

penilaian dalam pembelajaran keterampilan

menulis cerpen meliputi: 1) Kelengkapan

aspekformalcerpen, 2)Kelengkapanunsur

intrinsik cerpen, 3) Keterpaduan unsur/

struktur cerpen, 4) Kesesuaian penggunaan

bahasacerpen.

Teknik Analisis Data

Teknikanalisisdatayangdigunakan

dalam penelitian ini adalah teknik analisis

kritis. Teknik analisis tersebut bermaksud

mengungkap kekurangan dan kelebihan

keterampilan siswa selama proses pem-

belajaran di dalam kelas. Analisis kritis

terhadapketerampilanmenuliscerpensiswa

mencakupaspekformalcerpen yangditulis

siswa,unsurintrinsikcerpenyangdigunakan,

struktur cerpen serta penggunaan bahasa

cerpen. Ke empat aspek ini mencakup

kreativitas siswa dalam menentukan ide

cerita serta mengembangkannya seunik

mungkin. Adapun analisis kritis yang

dilakukan terhadap proses pembelajaran

yang berlangsung meliputi hasil tes serta

keaktifan terhadap pembelajaran menulis

cerpen.

Prosedur Penelitian

Prosedur penelitian merupakan

rangkaian tahapan penelitian dari awal

hinggaakhirpenelitian.Penelitianiniadalah

proses pengka j i an s i s tem berdaur

sebagaimana kerangka berpikir. Prosedur

dalam Penelitian Tindakan Kelas ini

mencakuplangkah-langkah:1)persiapan,2)

studi/survei awal,3) pelaksanaansiklus,4)

penyusunan laporan. Pelaksanaan siklus

meliputi:a)perencanaantindakan(planning),

b) pelaksanaan tindakan (acting), c)

pengamatan (observing) , d) re�leksi

(re�lecting). Banyaknya siklus yang telah

dilaksanakan ada tiga mengingat dalam

penelitiantindakanini,padasiklusterakhir

(siklusIII)telahmencapaiindikatorkinerja

ataucapaianyangtelahditetapkan.Berikut

ini adalah bagan prosedur Penelitian

Tindakan Kelas yang digunakan sesuai

dengan yang digambarkan oleh Suharsimi

Arikunto,SuhardjonodanSupardi.

Gambar 1: Prosedur Penelitian Tindakan Kelas(SuharsimiArikunto,Suhardjono,danSupardi,2007:74)

Page 31: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

30 31

ber�ikir ini, memungkinkan individu

berpindah-pindah topik”. Individu merekam

informasi melalui simbol, gambar, arti

emosional, danwarna”.Mekanisme ini sama

persisdengancaraotakmemperosesberbagai

informasi yang masuk. Dan karena peta

pikiran melibatkan kedua belah otak, anda

dapat mengingat informasi dengan lebih

mudah.

TeknikMindMapingmenuntutsiswa

untuk menguasai bagian demi bagian dari

bahan yang diajarkan kemudian bertukar

pikiran dengan siswa lain dan saling

mengajari satu sama lain. Selain itu, siswa

bekerjadengansesamasiswadalamsuasana

gotong royong dan mempunyai banyak

kesempatan untuk mengolah informasi dan

meningkatkankemampuanberkomunikasi.

KerangkaBerpikir

Berdasar pada permasalahan yang

ada, dipilihlah metode peta pikiran (mind

mapping)untukmengatasipermasalahan

tersebut. Metode ini dipilih untuk

melakukan pencatatan secara ringkas dan

sistematis serta dapat mengembangkan

gagasan karena rangsang visual berupa

gambar serta warna yang ditawarkan. Di

samping itu,metode ini diharapkanmampu

mengoptimalkan fungsi kerja otak kanan

sehingga dapat membangkitkan kreativitas

danimajinasiyangsangatdiperlukandalam

kegiatanmenulisceritapendek.Siswadapat

mengembangkan idedaripetapikiranyang

telahdibuatsehinggatidaklagikehabisanide.

Hal ini akan lebih mengefekti�kan waktu

pembelajaran.

Daripenerapanmetodepetapikran

tersebutdiharapkanterjadipeningkatanbaik

pada kualitas proses pembelajaran yang

ditandai dengan peningkatan keaktifan,

perhatian,konsentrasi,minat,danmotivasi

siswaterhadappembelajaranmenuliscerita

pendek,maupunketerampilanmenuliscerita

pendek yang ditandai dengan peningkatan

kreativitas, imajinasi, pengorganisasian

paragraf, pemanfaatan potensi kata,

pengembanganbahasa,mekanikpadacerpen

karangansiswadanketuntasanbelajar.

Hipotesis Tindakan

Berdasarkan kajian teori dan

kerangka berpikir di atas, dapat diajukan

hipotesisdalampenelitiantindakankelasini

sebagai berikut: Dengan menggunakan

metode peta pikiran (mindmapping) dalam

pembelajaran Bahasa Indonesia, khususnya

menulis cerita pendek, hasil keterampilan

menulisceritapendeksiswakelas X.6SMP

Negeri 1 Tanjungpinang Tahun Pelajaran

2015/2016.

METODOLOGI PENELITIAN

Jenis Penelitian

Penelitian ini berjenis Penelitian

TindakanKelas (ClassroomActionResearch).

Penelitian ini bertujuan untuk mengetahui

ada tidaknya peningkatan keterampilan

menulis cerpen siswa dengan penerapan

metode pembelajaran peta pikiran (mind

mapping). Strategi yang digunakan dalam

penelitian ini adalah deskriptif kualitatif.

Strategi ini bertujuan untuk meng-

gambarkan serta menjelaskan kenyataan

di lapangan. Kenyataan yang dimaksud

adalahprosespembelajaranmenuliscerpen

sebelumdansesudahdiberitindakanberupa

penerapanmetodepembelajaranpetapikiran

(mindmapping).

SubjekdanObjekPenelitian

Subjek penelitian adalah siswa kelas

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran 2015/2016 yang berjumlah 32

siswa.Sedangkanobjekpenelitianmencakup

proses pembelajaran menulis cerpen dan

penilaianketerampilanmenuliscerpensiswa

IX.6 SMP Negeri 1 Tanjungpinang Tahun

Pelajaran 2015/2016 melalui penerapan

metode pembelajaran peta pikiran (mind

mapping).

Teknik Pengumpulan Data

Data-data dalam penelitian ini

dikumpulkandengantekniksebagaiberikut:

1) Observasi, dilakukan untuk mengetahui

peningkatanpembelajaranyangdicapaioleh

siswa. Teknik ini dilakukan sejak sebelum

tindakandiberikan,saattindakandiberikan

hingga akhir tindakan; 2) Tes menulis

cerpen, tes ini dilakukan untuk mengukur

kemampuan bercerita siswa sebelum dan

sesudah dikenai tindakan. Adapun aspek

penilaian dalam pembelajaran keterampilan

menulis cerpen meliputi: 1) Kelengkapan

aspekformalcerpen, 2)Kelengkapanunsur

intrinsik cerpen, 3) Keterpaduan unsur/

struktur cerpen, 4) Kesesuaian penggunaan

bahasacerpen.

Teknik Analisis Data

Teknikanalisisdatayangdigunakan

dalam penelitian ini adalah teknik analisis

kritis. Teknik analisis tersebut bermaksud

mengungkap kekurangan dan kelebihan

keterampilan siswa selama proses pem-

belajaran di dalam kelas. Analisis kritis

terhadapketerampilanmenuliscerpensiswa

mencakupaspekformalcerpen yangditulis

siswa,unsurintrinsikcerpenyangdigunakan,

struktur cerpen serta penggunaan bahasa

cerpen. Ke empat aspek ini mencakup

kreativitas siswa dalam menentukan ide

cerita serta mengembangkannya seunik

mungkin. Adapun analisis kritis yang

dilakukan terhadap proses pembelajaran

yang berlangsung meliputi hasil tes serta

keaktifan terhadap pembelajaran menulis

cerpen.

Prosedur Penelitian

Prosedur penelitian merupakan

rangkaian tahapan penelitian dari awal

hinggaakhirpenelitian.Penelitianiniadalah

proses pengka j i an s i s tem berdaur

sebagaimana kerangka berpikir. Prosedur

dalam Penelitian Tindakan Kelas ini

mencakuplangkah-langkah:1)persiapan,2)

studi/survei awal,3) pelaksanaansiklus,4)

penyusunan laporan. Pelaksanaan siklus

meliputi:a)perencanaantindakan(planning),

b) pelaksanaan tindakan (acting), c)

pengamatan (observing) , d) re�leksi

(re�lecting). Banyaknya siklus yang telah

dilaksanakan ada tiga mengingat dalam

penelitiantindakanini,padasiklusterakhir

(siklusIII)telahmencapaiindikatorkinerja

ataucapaianyangtelahditetapkan.Berikut

ini adalah bagan prosedur Penelitian

Tindakan Kelas yang digunakan sesuai

dengan yang digambarkan oleh Suharsimi

Arikunto,SuhardjonodanSupardi.

Gambar 1: Prosedur Penelitian Tindakan Kelas(SuharsimiArikunto,Suhardjono,danSupardi,2007:74)

Page 32: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

32 33

Penjelasan secara garis besar

mengenai masing-masing langkah tersebut

diuraikan sebagai berikut: Pelaksanaan

pembelajaran cerpen pada setiap siklus

meliputiempattahap,yaitu:

1. Perencanaan (planning), berdasar pada

hasilident�ikasisertapenetapanmasalah

dari kegiatan observasi survei awal,

penelitimengajukanalternatifpemecahan

masalahdenganmenerapkanmetodepeta

pikiran (mind mapping) dalam pem-

belajaran menulis cerpen. Pada tahap

ini, peneliti menyusun skenario

pembelajaran yang menerapkan metode

petapikiran(mindmapping).

2. Pelaksanaan(acting),tindakanyangtelah

direncanakan serta disepakati oleh

penelitidiimplementasikandalambentuk

pembelajaran menulis cerpen yang

menerapkan metode peta pikiran (mind

mapping) . Pe laksanaan t indakan

diwujudkan dalam langkah-langkah

pembelajaran yang sistematis. Secara

garisbesar,sebelumsiswapraktikmenulis

cerpen, guru tetap memberikan materi.

Materiyangdiberikantidakterbataspada

teori tentangmenuliscerpenakantetapi

langkah-langkahpraktismenulis cerpen

juga diberikan sebagai bahan

pembelajaran.Setelahitu,siswaditugasi

untukmembuat perencanaan penulisan

cerpen dalambentukpetapikiran(mind

mapping). Berdasar pada peta itulah,

siswa menulis cerpen. Beberapa cerpen

yang ditulis siswa dibaca di depan kelas

dan d i tanggapi o leh s iswa la in .

Selanjutnya, guru menilai cerpen siswa

sertamemberimasukanuntukperbaikan

cerpensiswa.

3. Observasi, dilakukan peneliti saat

p emb e l a j a r a n m e n u l i s c e r p e n

berlangsung. Observasi berupa kegiatan

pemantauan, pencatatan, serta pen-

dokumentasian segala kegiatan selama

pelaksanaan pembelajaran. Data yang

diperoleh dari kegiatan observasi

kemudian diinterpretasi guna me-

ngetahuikelebihandankekurangandari

tindakanyangdilakukan.

4. Re�leksi, pada tahap ini, peneliti

menganalisis data yang telah terkumpul

dari hasil observasi. Dari hasil analisis

berupa kelemahan-kelemahan dalam

pembelajaran, peneliti menentukan

langkah-langkah perbaikan yang akan

dilakukan pada siklus berikutnya. Dari

tahapan ini pula diketahui berhasil

tidaknyatindakanyangtelahdiberikan.

Indikator Keberhasilan

Keterampilan menulis cerpen siswa,

ditandai dengan ketuntasan hasil belajar

siswa yang memperoleh nilai 65 (KKM)

mencapai minimal 85% dari jumlah siswa.

Untukmengetahuipeningkatankemampuan

menulis cerpen siswa, penelitimengamati

hasilpekerjaansiswaberupacerpendan

menghitung skor/capaian yang diperoleh

siswaberdasarkanpedomanpenilaianyang

telahdisiapkanolehpeneliti.

HASIL PENELITIAN DAN

PEMBAHASAN

Hasil Penelitian

Hasil penilaian tes keterampilan

menceritakan kemabali isi cerpen siswa

sebelumdikenaitindakanadalahbahwasetiap

aspek dalam proses belajar mengajar

termasukdalamkategorikurang.

Tabel 1 : Hasil penilaian Tes KeterampilansiswaMenulisCerpen(Prasiklus)

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

15

2 Siswa yang memperoleh

nilai

<

65

17

3 NilaiTertinggi 78

4 NilaiTerendah

45

5 Nilai rata-rata

61,88

6 Ketuntasan klasikal 47,88%

SiklusI,dibandingkan dengan nilai

pretesmenuliscerpen,nilairata-ratakelas

meningkat sebesar 3,97 poin dari 61,88

menjadi 65,84. Nilai tertinggi yang diraih

siswa adalah 80. Dannilai terendah siswa

ada l ah 50 . Adapun p en ingka t an

ke terampi lan menul i s cerpen s i swa

tercermindariperolehannilaimenuliscerpen

padasiklusIberikutini.

Tabel 2 : PerolehanNilaiTesKeterampilanMenulisCerpenpadaSiklusI

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

20

2 Siswa yang memperoleh

nilai

<

65

12

3 NilaiTertinggi 80

4 NilaiTerendah

50

5 Nilai rata-rata

65,84

6 Ketuntasan klasikal 62,50%

Hasiltesyangdisajikanpadatabeldi

atas, menunjukkan sejumlah 12 siswa

mendapatnilaikurangdari65.Sebanyak20

siswamendapatnilai65ataulebih.Nilairata-

rata kelas 75,84. Ketuntasan secara klasikal

sebesar62,50%.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus I

dikatakan berhasil akan tetapi belum

mencapai hasilyangmaksimal. Peningkatan

memang terjadi pada beberapa indikator

yang telah ditentukan pada survei awal.

Akan tetapi, nilai ketuntasan klasikalnya

hanya 62,50%. Oleh karena itulah, siklus II

sebagaiperbaikanprosespembelajaranpada

siklusIperludilaksanakan.

Siklus II, dari hasil pengamatan

penelitipadatindakansiklusII,cerpenyang

ditulissiswapadasiklus II,diketahuibahwa

terjadi peningkatan kemampuan menulis

siswa.Skordalamtiapaspekpenulisancerpen

menga lami pen ingka tan . Beberapa

kelemahanyangditemuidalamcerpensiswa

pada siklus II ini adalah pembuatan kon�lik

serta alur cerpen. Cerpen yang dihasilkan

siswatidakmemilikisuspenseyangkuat.Oleh

karenaitu,pembuatanalursertakon�likcerita

perlu disampaikan kembali pada siklus

berikutnya. Berikut ini disajikan data

perolehan nilai menulis cerpen siswa pada

siklusII.

Tabel 3 : Perolehan Nilai Tes KeterampilanMenulisCerpenpadaSiklusII

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

≥65

25

2 Siswa yang memperoleh

nilai

<

65

7

3 NilaiTertinggi 85

4 NilaiTerendah

60

5 Nilai rata-rata

70,31

6 Ketuntasan klasikal 78,13%

Hasil nilai pada tabel di atas,

menunjukkan7siswamendapatnilaikurang

dari (di bawah) 65. Sebanyak 25 siswa

mendapatnilai65ataulebih.Nilaireratakelas

70,31. Ketuntasan secara klasikal sebesar

78,13%.Berdasarkanhasil tersebut, dapat

diketahui bahwa nilai rerata yang dicapai

sudah memenuhi indikator kinerja. Namun,

secaraklasikalbelummencapaibatastuntas.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus II

dikatakan berhasil akan tetapi belum

mencapai hasilyangmaksimal. Peningkatan

memang terjadi pada beberapa indikator

dibandingkan siklus sebelumnya. Nilai rata-

ratakelas sudahmencapaibatasketuntasan

meskipun masih ada 7 siswa yang belum

Page 33: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

32 33

Penjelasan secara garis besar

mengenai masing-masing langkah tersebut

diuraikan sebagai berikut: Pelaksanaan

pembelajaran cerpen pada setiap siklus

meliputiempattahap,yaitu:

1. Perencanaan (planning), berdasar pada

hasilident�ikasisertapenetapanmasalah

dari kegiatan observasi survei awal,

penelitimengajukanalternatifpemecahan

masalahdenganmenerapkanmetodepeta

pikiran (mind mapping) dalam pem-

belajaran menulis cerpen. Pada tahap

ini, peneliti menyusun skenario

pembelajaran yang menerapkan metode

petapikiran(mindmapping).

2. Pelaksanaan(acting),tindakanyangtelah

direncanakan serta disepakati oleh

penelitidiimplementasikandalambentuk

pembelajaran menulis cerpen yang

menerapkan metode peta pikiran (mind

mapping) . Pe laksanaan t indakan

diwujudkan dalam langkah-langkah

pembelajaran yang sistematis. Secara

garisbesar,sebelumsiswapraktikmenulis

cerpen, guru tetap memberikan materi.

Materiyangdiberikantidakterbataspada

teori tentangmenuliscerpenakantetapi

langkah-langkahpraktismenulis cerpen

juga diberikan sebagai bahan

pembelajaran.Setelahitu,siswaditugasi

untukmembuat perencanaan penulisan

cerpen dalambentukpetapikiran(mind

mapping). Berdasar pada peta itulah,

siswa menulis cerpen. Beberapa cerpen

yang ditulis siswa dibaca di depan kelas

dan d i tanggapi o leh s iswa la in .

Selanjutnya, guru menilai cerpen siswa

sertamemberimasukanuntukperbaikan

cerpensiswa.

3. Observasi, dilakukan peneliti saat

p emb e l a j a r a n m e n u l i s c e r p e n

berlangsung. Observasi berupa kegiatan

pemantauan, pencatatan, serta pen-

dokumentasian segala kegiatan selama

pelaksanaan pembelajaran. Data yang

diperoleh dari kegiatan observasi

kemudian diinterpretasi guna me-

ngetahuikelebihandankekurangandari

tindakanyangdilakukan.

4. Re�leksi, pada tahap ini, peneliti

menganalisis data yang telah terkumpul

dari hasil observasi. Dari hasil analisis

berupa kelemahan-kelemahan dalam

pembelajaran, peneliti menentukan

langkah-langkah perbaikan yang akan

dilakukan pada siklus berikutnya. Dari

tahapan ini pula diketahui berhasil

tidaknyatindakanyangtelahdiberikan.

Indikator Keberhasilan

Keterampilan menulis cerpen siswa,

ditandai dengan ketuntasan hasil belajar

siswa yang memperoleh nilai 65 (KKM)

mencapai minimal 85% dari jumlah siswa.

Untukmengetahuipeningkatankemampuan

menulis cerpen siswa, penelitimengamati

hasilpekerjaansiswaberupacerpendan

menghitung skor/capaian yang diperoleh

siswaberdasarkanpedomanpenilaianyang

telahdisiapkanolehpeneliti.

HASIL PENELITIAN DAN

PEMBAHASAN

Hasil Penelitian

Hasil penilaian tes keterampilan

menceritakan kemabali isi cerpen siswa

sebelumdikenaitindakanadalahbahwasetiap

aspek dalam proses belajar mengajar

termasukdalamkategorikurang.

Tabel 1 : Hasil penilaian Tes KeterampilansiswaMenulisCerpen(Prasiklus)

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

15

2 Siswa yang memperoleh

nilai

<

65

17

3 NilaiTertinggi 78

4 NilaiTerendah

45

5 Nilai rata-rata

61,88

6 Ketuntasan klasikal 47,88%

SiklusI,dibandingkan dengan nilai

pretesmenuliscerpen,nilairata-ratakelas

meningkat sebesar 3,97 poin dari 61,88

menjadi 65,84. Nilai tertinggi yang diraih

siswa adalah 80. Dannilai terendah siswa

ada l ah 50 . Adapun p en ingka t an

ke terampi lan menul i s cerpen s i swa

tercermindariperolehannilaimenuliscerpen

padasiklusIberikutini.

Tabel 2 : PerolehanNilaiTesKeterampilanMenulisCerpenpadaSiklusI

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

20

2 Siswa yang memperoleh

nilai

<

65

12

3 NilaiTertinggi 80

4 NilaiTerendah

50

5 Nilai rata-rata

65,84

6 Ketuntasan klasikal 62,50%

Hasiltesyangdisajikanpadatabeldi

atas, menunjukkan sejumlah 12 siswa

mendapatnilaikurangdari65.Sebanyak20

siswamendapatnilai65ataulebih.Nilairata-

rata kelas 75,84. Ketuntasan secara klasikal

sebesar62,50%.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus I

dikatakan berhasil akan tetapi belum

mencapai hasilyangmaksimal. Peningkatan

memang terjadi pada beberapa indikator

yang telah ditentukan pada survei awal.

Akan tetapi, nilai ketuntasan klasikalnya

hanya 62,50%. Oleh karena itulah, siklus II

sebagaiperbaikanprosespembelajaranpada

siklusIperludilaksanakan.

Siklus II, dari hasil pengamatan

penelitipadatindakansiklusII,cerpenyang

ditulissiswapadasiklus II,diketahuibahwa

terjadi peningkatan kemampuan menulis

siswa.Skordalamtiapaspekpenulisancerpen

menga lami pen ingka tan . Beberapa

kelemahanyangditemuidalamcerpensiswa

pada siklus II ini adalah pembuatan kon�lik

serta alur cerpen. Cerpen yang dihasilkan

siswatidakmemilikisuspenseyangkuat.Oleh

karenaitu,pembuatanalursertakon�likcerita

perlu disampaikan kembali pada siklus

berikutnya. Berikut ini disajikan data

perolehan nilai menulis cerpen siswa pada

siklusII.

Tabel 3 : Perolehan Nilai Tes KeterampilanMenulisCerpenpadaSiklusII

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

≥65

25

2 Siswa yang memperoleh

nilai

<

65

7

3 NilaiTertinggi 85

4 NilaiTerendah

60

5 Nilai rata-rata

70,31

6 Ketuntasan klasikal 78,13%

Hasil nilai pada tabel di atas,

menunjukkan7siswamendapatnilaikurang

dari (di bawah) 65. Sebanyak 25 siswa

mendapatnilai65ataulebih.Nilaireratakelas

70,31. Ketuntasan secara klasikal sebesar

78,13%.Berdasarkanhasil tersebut, dapat

diketahui bahwa nilai rerata yang dicapai

sudah memenuhi indikator kinerja. Namun,

secaraklasikalbelummencapaibatastuntas.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus II

dikatakan berhasil akan tetapi belum

mencapai hasilyangmaksimal. Peningkatan

memang terjadi pada beberapa indikator

dibandingkan siklus sebelumnya. Nilai rata-

ratakelas sudahmencapaibatasketuntasan

meskipun masih ada 7 siswa yang belum

Page 34: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

34 35

mencapaibatasketuntasanbelajarminimal

tersebut.Disampingitu,padacerpensiswa

masih ditemui kekurangan yaitu tidak

tersubstansinyaalursertakon�likyangtajam.

Olehkarenaitulah,siklusIIIsebagaiperbaikan

proses pembelajaran pada siklus II perlu

dilaksanakan.

Siklus III, dari hasil pengamatan

peneliti pada tindakan siklus III dapat

dikemukakan keteranpilan siswa dalam

menulis cerpen mengalami peningkatan.

Haliniterlihat dari tercapainyasejumlah

indikator yang telah ditetapkan, seperti

meningkatnya keaktifan, perhatian serta

konsentrasi siswa dalam pembelajaran. Di

samping itu, kekurangan-kekurangan yang

ditemui dalam siklus II telah dapat diatasi

denganbaikolehgurupadasiklusIII.Teknik-

teknik yang diterapkan guru terbukti dapat

meningkatkan keaktifan, partisipasi, minat

sertaperhatiansiswaterhadappembelajaran.

Pada siklus ini, masing-masing skor siswa

meningkat dan hampir semua siswa telah

mencapai batas minimal (65). Peningkatan

kemampuanmenulis cerpen siswa ini dapat

dilihatpadacapaianskormenulisberikutini.

Tabel 4 : Perolehan Nilai Tes KeterampilanMenulisCerpenpadaSiklusIII

Hasilpadatabeldiatas,menunjukkan

bahwa hanya 2 siswa yangmendapat nilai

kurangdari(dibawah)65.Sebanyak30siswa

mendapat nilai 65 atau lebih. Secara

individual, hampir semua siswa telah

memenuhibatastuntas. Nilairata-ratakelas

73,81. Ketuntasan secara klasikal sebesar

93,75%. Berdasarkan hasil tersebut, dapat

diketahui bahwa nilai rerata maupun

ketuntasanklasikal yangdicapai siswa telah

memenuhiindikatorkinerja.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus III

dikatakanberhasil.Peningkatanterjadipada

beberapa indikator dibandingkan siklus

sebelumnya. Nilai rata-rata kelas maupun

ketuntasan klasikal telah mencapai sesuai

denganindikatorkinerja.

Pembahasan

Berdasar pada permasalahan yang

dirumuskan dalam bagian pendahuluan

serta paparan hasil penelitian, berikut ini

dijabarkanpembahasanhasilpenelitianyang

meliputi keterampilanmenulis cerpen siswa

kelasIX.6SMPNegeri1TanjungpinangTahun

Pelajaran2015/2016.

Peningkatan kualitas pembelajaran

menulis cerpen juga berimplikasi pada

kemampuan siswa menulis cerpen.

Kemampuan siswa menulis cerpen juga

mengalami peningkatan. Hal ini terlihat

dari cerpen yangditulis siswa pada tiap

siklusmengalamipeningkatan.

Dari pretes yang dilakukan pada

survei awal, diketahui bahwa kemampuan

menulis cerpen siswa masih tergolong

rendah.Hal ini terlihat dari capaian nilai

menul is cerpen s iswa. Peningkatan

kemampuanmenulis cerpen siswapersiklus

dapatdilihatpadatabeldangra�ikdibawah

ini.

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

30

2 Siswa yang memperoleh

nilai

<

65

2

3 NilaiTertinggi

90

4 NilaiTerendah

63

5 Nilai rata-rata

73,81

6 Ketuntasan klasikal 93,75%

Tabel 5 : Hasil Tes Keterampilan MenulisCerpenSiswapadaTiapSiklus

NO NAMASISWA

NILAI

Prasiklus SiklusI

Siklus

II

siklus

III

1 ADITYARIZALRAMADHAN 54 60 65 71

2 AHMADFIKRIWAHYUDI 65 68 73 76

3 DAVID 66 70 75 78

4 DICKYPRATAMA 78 78 83 85

5 DINDASAFITRI 45 54 60 68

6 EUNICEKLESIA 58 65 66 70

7 EVELYNANGELIKA

66

70

71 74

8 FATAHAKBARYANTO

48

55

63 65

9 FERNANDOHAFIS

54

65

70 77

10 JAVIERPAULUS

65

70

73 75

11 JOGIPRANATASIDABUTAR

62

65

75 77

12 KHERLIN 60

63

73 75

13 MARDIANAWIDYANINGRUM

75

77

80 86

14 MEGAHFITRIANA

65

66

72 74

15 MUHAMADIRVANNURMANSYAH

64

68

70 70

16 MUHAMMADFACHRIHAIKAL

5056

60 65

17 MUHAMMADNUGRAIVANKA

YURIZ

4556

60 63

18 MUHAMMADRIDHOEKASYAHPUTRA

70

73

74 75

19 MUTIARASUNDARISAPUTRI

65

68

70 70

20 NADYAREZAPUSPITA

51

56

62 65

21 NOLAVIDYADEWI

67

70

75 77

22 OCTOVIA 70

75

77 82

23 PUTRIMEGAMEILANI

78

80

85 90

24 RIZKYARJUNA

63

65

69 70

25 SINTAKURNIA

61

62

64 65

26 SURYA 72

75

80 83

27 SUWANDI 52 55 60 63

28 SYARIFAHSITIZAHARA 66 66 69 74

29 TIMOTHYSUTANTOSIMAMORA 46 50 60 65

30 WIDIAKARTIKADISARI.P 78 79 85 90

31 YURICOALEXANDER 61 63 66 70

32 YUSSIAYUNI 60 64 65 74

Siswayangmemperolehnilai=65 15 20 25 30

Siswayangmemperolehnilai<65 17 12 7 2

NilaiTertinggi 78 80 85 90

Gra�ik1.PeningkatanKeterampilanMenulisCerpenSiswapadaTiapSiklus

Hasilreratatesketerampilanmenulis

cerpensiswapadakondisiawaladalah61,88.

Setelah diberikan tindakan perbaikan pada

siklusI,meningkatdarirerata61,88menjadi

65,84. Dari segi ketuntasan belajarsecara

individual maupun secara klasikal, hasil

tersebut belum mencapai tujuan yang

diharapkan.Dari32jumlahsiswa,tercatat12

siswabelummencapaibatastuntas,20siswa

telahmencapaibatastuntas.

Pada siklus II terjadi peningkatan

ketuntasan belajar siswa, 25 siswa telah

mencapai batas tuntas dan 7 siswa belum

mencapai batas tuntas, Ketuntasan secara

klasiakalmeningkatmenjadi78,13%,namun

secara klasikal juga belum memenuhi

batasketuntasanyangtelahditetapkan.

SiklusIIIjugamengalamipeningkatan

ketuntasan belajar siswa, dari 32 siswa 30

siswamencapaibatastuntasdanhanya2siswa

yang be lum mencapa i ba ta s tun tas .

Ketuntasan secara klasiakal tercatat

93,75%. Dengan demikian, secara klasikal

telahmemenuhibatasketuntasanyang telah

ditetapkanyaitu85%.

SIMPULANDANSARAN

Simpulan

Berdasarkan tindakan kelas yang

dilakukan, dan hasil analisis, dapat ditarik

simpulandaripenelitianinisebagaiberikut:1)

Penerapan metode pembelajaran peta

p i k i r a n (m i n d m a p p i n g ) d a p a t

meningkatkankualitasprosespembelajaran

menuliscerpen.Haliniditandaidengan

keaktifan, perhatian, konsentrasi, minat dan

motivasi siswa dalam pembelajaran menulis

cerpen yang mengalami peningkatan dalam

t iap s iklusnya; 2) Penerapan metode

pembelajaran peta pikiran (mind mapping)

dapat meningkatkan keterampilan siswa

dalammenuliscerpen.Haliniditandaidengan

nilairata-ratamenulissiswayangmengalami

peningkatanpadatiapsiklusnya,yaitusiklusI

sebesa 65,84; siklus II sebesar 70,31, dan

siklusIIIsebesar73,81;3)dapatdisimpulkan

bahwa metode pembelajaran peta pikiran

(mind mapping) ini sangat efektif jika

digunakan dalam pembelajaran menulis

cerpen.

Page 35: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

34 35

mencapaibatasketuntasanbelajarminimal

tersebut.Disampingitu,padacerpensiswa

masih ditemui kekurangan yaitu tidak

tersubstansinyaalursertakon�likyangtajam.

Olehkarenaitulah,siklusIIIsebagaiperbaikan

proses pembelajaran pada siklus II perlu

dilaksanakan.

Siklus III, dari hasil pengamatan

peneliti pada tindakan siklus III dapat

dikemukakan keteranpilan siswa dalam

menulis cerpen mengalami peningkatan.

Haliniterlihat dari tercapainyasejumlah

indikator yang telah ditetapkan, seperti

meningkatnya keaktifan, perhatian serta

konsentrasi siswa dalam pembelajaran. Di

samping itu, kekurangan-kekurangan yang

ditemui dalam siklus II telah dapat diatasi

denganbaikolehgurupadasiklusIII.Teknik-

teknik yang diterapkan guru terbukti dapat

meningkatkan keaktifan, partisipasi, minat

sertaperhatiansiswaterhadappembelajaran.

Pada siklus ini, masing-masing skor siswa

meningkat dan hampir semua siswa telah

mencapai batas minimal (65). Peningkatan

kemampuanmenulis cerpen siswa ini dapat

dilihatpadacapaianskormenulisberikutini.

Tabel 4 : Perolehan Nilai Tes KeterampilanMenulisCerpenpadaSiklusIII

Hasilpadatabeldiatas,menunjukkan

bahwa hanya 2 siswa yangmendapat nilai

kurangdari(dibawah)65.Sebanyak30siswa

mendapat nilai 65 atau lebih. Secara

individual, hampir semua siswa telah

memenuhibatastuntas. Nilairata-ratakelas

73,81. Ketuntasan secara klasikal sebesar

93,75%. Berdasarkan hasil tersebut, dapat

diketahui bahwa nilai rerata maupun

ketuntasanklasikal yangdicapai siswa telah

memenuhiindikatorkinerja.

Berdasarkan hasil analisis dan

re�leksi di atas, tindakan pada siklus III

dikatakanberhasil.Peningkatanterjadipada

beberapa indikator dibandingkan siklus

sebelumnya. Nilai rata-rata kelas maupun

ketuntasan klasikal telah mencapai sesuai

denganindikatorkinerja.

Pembahasan

Berdasar pada permasalahan yang

dirumuskan dalam bagian pendahuluan

serta paparan hasil penelitian, berikut ini

dijabarkanpembahasanhasilpenelitianyang

meliputi keterampilanmenulis cerpen siswa

kelasIX.6SMPNegeri1TanjungpinangTahun

Pelajaran2015/2016.

Peningkatan kualitas pembelajaran

menulis cerpen juga berimplikasi pada

kemampuan siswa menulis cerpen.

Kemampuan siswa menulis cerpen juga

mengalami peningkatan. Hal ini terlihat

dari cerpen yangditulis siswa pada tiap

siklusmengalamipeningkatan.

Dari pretes yang dilakukan pada

survei awal, diketahui bahwa kemampuan

menulis cerpen siswa masih tergolong

rendah.Hal ini terlihat dari capaian nilai

menul is cerpen s iswa. Peningkatan

kemampuanmenulis cerpen siswapersiklus

dapatdilihatpadatabeldangra�ikdibawah

ini.

No Uraian Pencapaian Hasil Jumlah / Nilai

1 Siswa yang memperoleh

nilai

=

65

30

2 Siswa yang memperoleh

nilai

<

65

2

3 NilaiTertinggi

90

4 NilaiTerendah

63

5 Nilai rata-rata

73,81

6 Ketuntasan klasikal 93,75%

Tabel 5 : Hasil Tes Keterampilan MenulisCerpenSiswapadaTiapSiklus

NO NAMASISWA

NILAI

Prasiklus SiklusI

Siklus

II

siklus

III

1 ADITYARIZALRAMADHAN 54 60 65 71

2 AHMADFIKRIWAHYUDI 65 68 73 76

3 DAVID 66 70 75 78

4 DICKYPRATAMA 78 78 83 85

5 DINDASAFITRI 45 54 60 68

6 EUNICEKLESIA 58 65 66 70

7 EVELYNANGELIKA

66

70

71 74

8 FATAHAKBARYANTO

48

55

63 65

9 FERNANDOHAFIS

54

65

70 77

10 JAVIERPAULUS

65

70

73 75

11 JOGIPRANATASIDABUTAR

62

65

75 77

12 KHERLIN 60

63

73 75

13 MARDIANAWIDYANINGRUM

75

77

80 86

14 MEGAHFITRIANA

65

66

72 74

15 MUHAMADIRVANNURMANSYAH

64

68

70 70

16 MUHAMMADFACHRIHAIKAL

5056

60 65

17 MUHAMMADNUGRAIVANKA

YURIZ

4556

60 63

18 MUHAMMADRIDHOEKASYAHPUTRA

70

73

74 75

19 MUTIARASUNDARISAPUTRI

65

68

70 70

20 NADYAREZAPUSPITA

51

56

62 65

21 NOLAVIDYADEWI

67

70

75 77

22 OCTOVIA 70

75

77 82

23 PUTRIMEGAMEILANI

78

80

85 90

24 RIZKYARJUNA

63

65

69 70

25 SINTAKURNIA

61

62

64 65

26 SURYA 72

75

80 83

27 SUWANDI 52 55 60 63

28 SYARIFAHSITIZAHARA 66 66 69 74

29 TIMOTHYSUTANTOSIMAMORA 46 50 60 65

30 WIDIAKARTIKADISARI.P 78 79 85 90

31 YURICOALEXANDER 61 63 66 70

32 YUSSIAYUNI 60 64 65 74

Siswayangmemperolehnilai=65 15 20 25 30

Siswayangmemperolehnilai<65 17 12 7 2

NilaiTertinggi 78 80 85 90

Gra�ik1.PeningkatanKeterampilanMenulisCerpenSiswapadaTiapSiklus

Hasilreratatesketerampilanmenulis

cerpensiswapadakondisiawaladalah61,88.

Setelah diberikan tindakan perbaikan pada

siklusI,meningkatdarirerata61,88menjadi

65,84. Dari segi ketuntasan belajarsecara

individual maupun secara klasikal, hasil

tersebut belum mencapai tujuan yang

diharapkan.Dari32jumlahsiswa,tercatat12

siswabelummencapaibatastuntas,20siswa

telahmencapaibatastuntas.

Pada siklus II terjadi peningkatan

ketuntasan belajar siswa, 25 siswa telah

mencapai batas tuntas dan 7 siswa belum

mencapai batas tuntas, Ketuntasan secara

klasiakalmeningkatmenjadi78,13%,namun

secara klasikal juga belum memenuhi

batasketuntasanyangtelahditetapkan.

SiklusIIIjugamengalamipeningkatan

ketuntasan belajar siswa, dari 32 siswa 30

siswamencapaibatastuntasdanhanya2siswa

yang be lum mencapa i ba ta s tun tas .

Ketuntasan secara klasiakal tercatat

93,75%. Dengan demikian, secara klasikal

telahmemenuhibatasketuntasanyang telah

ditetapkanyaitu85%.

SIMPULANDANSARAN

Simpulan

Berdasarkan tindakan kelas yang

dilakukan, dan hasil analisis, dapat ditarik

simpulandaripenelitianinisebagaiberikut:1)

Penerapan metode pembelajaran peta

p i k i r a n (m i n d m a p p i n g ) d a p a t

meningkatkankualitasprosespembelajaran

menuliscerpen.Haliniditandaidengan

keaktifan, perhatian, konsentrasi, minat dan

motivasi siswa dalam pembelajaran menulis

cerpen yang mengalami peningkatan dalam

t iap s iklusnya; 2) Penerapan metode

pembelajaran peta pikiran (mind mapping)

dapat meningkatkan keterampilan siswa

dalammenuliscerpen.Haliniditandaidengan

nilairata-ratamenulissiswayangmengalami

peningkatanpadatiapsiklusnya,yaitusiklusI

sebesa 65,84; siklus II sebesar 70,31, dan

siklusIIIsebesar73,81;3)dapatdisimpulkan

bahwa metode pembelajaran peta pikiran

(mind mapping) ini sangat efektif jika

digunakan dalam pembelajaran menulis

cerpen.

Page 36: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

36 37

Saran

Berkaitan dengan simpulan serta

implikasi penelitian di atas, peneliti dapat

mengajukan saran-saran sebagai berikut:1)

Bag i s i swa , S i swa hendaknya dapat

menerapkan metode pembelajaran peta

pikiran (mind mapping), metode tersebut

tidakhanyadalamkegiatanmenuliscerpen

tetapi juga dalam kegiatan yang lain. Di

samping itu,siswahendaknya lebihbanyak

lagi membaca khususnya karya sastra agar

termotivasi untukmenulis; 2) bagi sekolah,

Sekolah disarankan untuk memotivasi guru

gunameningkatkankompetensinya,misalnya

denganmelakukanPenelitianTindakanKelas

dan mengikutsertakan guru dalam forum-

forum ilmiah seperti seminar pendidikan,

diklat,dansebagainya.Disampingitu,kepala

sekolah perlu memotivasi guru agar lebih

memperluas wawasan mengenai metode-

metode pembelajaran yang kreatif dan

inovat i f dan mendukung guru untuk

menerapkanmetode-metodetersebutdalam

pembelajaran;3)Bagiguru,disarankanuntuk

meningkatkan kompetensinya, misalnya

denganmelakukanpenelitiandanmengikuti

forum-forum ilmiah. Di samping itu. Guru

hendaknyamemperluas wawasanmengenai

metode-metodeyangkreatifdaninovatifserta

menerapkannya dalam pembelajaran.

Penerapan tersebut perlu memperhatikan

minat serta motivasi siswa. Metode yang

dapat diterapkan dalam pembelajaran

menuliscerpenkhususnyadanpembelajaran

Bahasa Indonesia pada umumnya adalah

metode pembelajaran peta pikiran (mind

mapping).

DAFTARPUSTAKA

Arikunto, Suharsimi , 2007. ProsedurPenelitianSuatuPendekatanPraktik.Jakarta:RinekaCipta

Aritonang,KekeTaruli,2013.CatatanHarianGuru:MenulisituMudah.Yogyakarta:CV.AndiOffset

Kurniawan, Heru, 2012. Penulisan SastraKreatif.Yogyakarta:GrahaIlmu

Munjin, Ahamad, 2009. Metode Dan TeknikPembelajaran. Bandung : PT Re�ikaAditama

Pujiono, Setyawan, 2013. Terampil MenulisCara Mudah dan Praktis DalamMenulis.Yogyakarta:GrahaIlmu

Purba, Antilan, 2012. Sastra IndonesiaKontemporer. Yogyakarta : GrahaIlmu

Trianto,2011.MendesainModelPembelajaranInovatif-Progresif.Jakarta:Kencana

Widyamartaya, A, 2005. Seni MenuangkanGagasan.Yogyakarta:Kanisius

IMPLEMENTASIMODELPEMBELAJARANKOOPERATIFUNTUKMENINGKATKANPENGUASAAN

KOSAKATABAHASADANSASTRAPERANCISSISWAKELASXIPA1SEMESTERGANJIL

TAHUNPELAJARAN2017/2018SMANEGERI3BATAM

DianaDevi*

Abstrack:ThisstudyaimstoimprovevocabularymasteryofFrenchlanguageandliterature.Thisresearchwasconductedthroughclassroomactionresearchintwocycles.Datacollectionisdonebyobservationandwritten tests. The research instrument used was test items, learning observation sheets, observerdiscussions and documentation. Research data in the implementation of learning were analyzedquantitatively.TheresultsshowedthattheimplementationofcooperativelearningmodelscanimprovethevocabularymasteryofstudentsandFrenchliterature.Intheprecycle,thepercentageofcompletenesswasonly57.14%withanaverageKKMof74.47.Thepercentageimprovementinlearningreached14.28%from74.29%inthe�irstcycleto88.57%inthesecondcycle.TheaverageKKMincreasedby7.88from81.00inthe�irstcycleto88.88inthesecondcycle.

KataKunci:cooperativelearningmodels,Frenchlanguageandliterature

PENDAHULUAN

Dalampengajaranbahasadan sastra

Perancisdikenalberbagaipendekatandengan

kelebihan dan kekurangannya masing-

masing. Hal tersebut berhubungan dengan

karakteristik sekolah maupun peserta didik

yangbelajardidalamnya.Kelebihanataupun

kekurangan pendekatan pembelajaran tidak

terletak pada esensi pendekatan itu sendiri

melainkanketerkaitandan implementasinya

didalamprosespembelajaran.Antaratingkat

kesukaran mata pelajaran dan kemampuan

akademik anak didik serta pendekatan,

motode,dan/atau teknikpembelajaranyang

akan diterapkan harus singkron satu sama

lain. Dengan demikian, partisipasi peserta

didikselamaKBMdapatdimaksimalkan.

Bahasa dan Sastra Perancis menjadi

bahasa asing kedua yang dipelajari peserta

didik setelah Bahasa Inggris ditingkat

SD/SMP.Kondisiinimenyebabkankurangnya

perbendaharaankosakataBahasadanSastra

Perancis peserta didik Kelas X IPA 1 SMA

Negeri 3 Batam yangmengakibatkan belum

mampumenyelesaikansoal-soaldenganhasil

yangsesuaistandaryangdiisyaratkandalam

kurikulum. Dari hasil pembelajaran awal di

kelasXIPA1SMANegeri3Batamdiperoleh

57.14%peserta didik tidak dapatmencapai

KKMyangditetapkanmeskipunnilairata-rata

cukuptinggiyaitu74.47.

Dari data diatas dapat dirumuskan

permasalahan yaitu apakah melalui

pengaplikasian model pembelajaran

kooperatif tutorsebayadapatmeningkatkan

penguasaan kosakata Bahasa dan Sastra

Perancispesertadidik.

Masalah kurangnya penguasaan

kosakataBahasadanSastraPerancismenjadi

faktor awal rendahnya hasil belajar peserta

didik. Untuk mengatasi permasalahan

tersebut, penulis berupaya melakukan

peningkatan penguasaan kosakata Bahasa

dan Sastra Perancis peserta didik melalui

pengaplikasian model pembelajaran

kooperatif. Salah satu keistimewaan model

pembelajaran kooperatif adalah adanya

pemberlakuan'tutorsebaya'sehinggapeserta

didik dapat terlibat langsung dalam

pembelajaran. Tujuan Penelitian ini adalah

untuk meningkatkan penguasaan kosakata

Page 37: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

36 37

Saran

Berkaitan dengan simpulan serta

implikasi penelitian di atas, peneliti dapat

mengajukan saran-saran sebagai berikut:1)

Bag i s i swa , S i swa hendaknya dapat

menerapkan metode pembelajaran peta

pikiran (mind mapping), metode tersebut

tidakhanyadalamkegiatanmenuliscerpen

tetapi juga dalam kegiatan yang lain. Di

samping itu,siswahendaknya lebihbanyak

lagi membaca khususnya karya sastra agar

termotivasi untukmenulis; 2) bagi sekolah,

Sekolah disarankan untuk memotivasi guru

gunameningkatkankompetensinya,misalnya

denganmelakukanPenelitianTindakanKelas

dan mengikutsertakan guru dalam forum-

forum ilmiah seperti seminar pendidikan,

diklat,dansebagainya.Disampingitu,kepala

sekolah perlu memotivasi guru agar lebih

memperluas wawasan mengenai metode-

metode pembelajaran yang kreatif dan

inovat i f dan mendukung guru untuk

menerapkanmetode-metodetersebutdalam

pembelajaran;3)Bagiguru,disarankanuntuk

meningkatkan kompetensinya, misalnya

denganmelakukanpenelitiandanmengikuti

forum-forum ilmiah. Di samping itu. Guru

hendaknyamemperluas wawasanmengenai

metode-metodeyangkreatifdaninovatifserta

menerapkannya dalam pembelajaran.

Penerapan tersebut perlu memperhatikan

minat serta motivasi siswa. Metode yang

dapat diterapkan dalam pembelajaran

menuliscerpenkhususnyadanpembelajaran

Bahasa Indonesia pada umumnya adalah

metode pembelajaran peta pikiran (mind

mapping).

DAFTARPUSTAKA

Arikunto, Suharsimi , 2007. ProsedurPenelitianSuatuPendekatanPraktik.Jakarta:RinekaCipta

Aritonang,KekeTaruli,2013.CatatanHarianGuru:MenulisituMudah.Yogyakarta:CV.AndiOffset

Kurniawan, Heru, 2012. Penulisan SastraKreatif.Yogyakarta:GrahaIlmu

Munjin, Ahamad, 2009. Metode Dan TeknikPembelajaran. Bandung : PT Re�ikaAditama

Pujiono, Setyawan, 2013. Terampil MenulisCara Mudah dan Praktis DalamMenulis.Yogyakarta:GrahaIlmu

Purba, Antilan, 2012. Sastra IndonesiaKontemporer. Yogyakarta : GrahaIlmu

Trianto,2011.MendesainModelPembelajaranInovatif-Progresif.Jakarta:Kencana

Widyamartaya, A, 2005. Seni MenuangkanGagasan.Yogyakarta:Kanisius

IMPLEMENTASIMODELPEMBELAJARANKOOPERATIFUNTUKMENINGKATKANPENGUASAAN

KOSAKATABAHASADANSASTRAPERANCISSISWAKELASXIPA1SEMESTERGANJIL

TAHUNPELAJARAN2017/2018SMANEGERI3BATAM

DianaDevi*

Abstrack:ThisstudyaimstoimprovevocabularymasteryofFrenchlanguageandliterature.Thisresearchwasconductedthroughclassroomactionresearchintwocycles.Datacollectionisdonebyobservationandwritten tests. The research instrument used was test items, learning observation sheets, observerdiscussions and documentation. Research data in the implementation of learning were analyzedquantitatively.TheresultsshowedthattheimplementationofcooperativelearningmodelscanimprovethevocabularymasteryofstudentsandFrenchliterature.Intheprecycle,thepercentageofcompletenesswasonly57.14%withanaverageKKMof74.47.Thepercentageimprovementinlearningreached14.28%from74.29%inthe�irstcycleto88.57%inthesecondcycle.TheaverageKKMincreasedby7.88from81.00inthe�irstcycleto88.88inthesecondcycle.

KataKunci:cooperativelearningmodels,Frenchlanguageandliterature

PENDAHULUAN

Dalampengajaranbahasadan sastra

Perancisdikenalberbagaipendekatandengan

kelebihan dan kekurangannya masing-

masing. Hal tersebut berhubungan dengan

karakteristik sekolah maupun peserta didik

yangbelajardidalamnya.Kelebihanataupun

kekurangan pendekatan pembelajaran tidak

terletak pada esensi pendekatan itu sendiri

melainkanketerkaitandan implementasinya

didalamprosespembelajaran.Antaratingkat

kesukaran mata pelajaran dan kemampuan

akademik anak didik serta pendekatan,

motode,dan/atau teknikpembelajaranyang

akan diterapkan harus singkron satu sama

lain. Dengan demikian, partisipasi peserta

didikselamaKBMdapatdimaksimalkan.

Bahasa dan Sastra Perancis menjadi

bahasa asing kedua yang dipelajari peserta

didik setelah Bahasa Inggris ditingkat

SD/SMP.Kondisiinimenyebabkankurangnya

perbendaharaankosakataBahasadanSastra

Perancis peserta didik Kelas X IPA 1 SMA

Negeri 3 Batam yangmengakibatkan belum

mampumenyelesaikansoal-soaldenganhasil

yangsesuaistandaryangdiisyaratkandalam

kurikulum. Dari hasil pembelajaran awal di

kelasXIPA1SMANegeri3Batamdiperoleh

57.14%peserta didik tidak dapatmencapai

KKMyangditetapkanmeskipunnilairata-rata

cukuptinggiyaitu74.47.

Dari data diatas dapat dirumuskan

permasalahan yaitu apakah melalui

pengaplikasian model pembelajaran

kooperatif tutorsebayadapatmeningkatkan

penguasaan kosakata Bahasa dan Sastra

Perancispesertadidik.

Masalah kurangnya penguasaan

kosakataBahasadanSastraPerancismenjadi

faktor awal rendahnya hasil belajar peserta

didik. Untuk mengatasi permasalahan

tersebut, penulis berupaya melakukan

peningkatan penguasaan kosakata Bahasa

dan Sastra Perancis peserta didik melalui

pengaplikasian model pembelajaran

kooperatif. Salah satu keistimewaan model

pembelajaran kooperatif adalah adanya

pemberlakuan'tutorsebaya'sehinggapeserta

didik dapat terlibat langsung dalam

pembelajaran. Tujuan Penelitian ini adalah

untuk meningkatkan penguasaan kosakata

Page 38: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

38 39

Bahasa dan Sastra Perancis peserta didik

melalui pengaplikasianmodel pembelajaran

kooperatiftutorsebaya.

KAJIANTEORI

PendekatanKooperatif

Pendekatan kooperatif adalah salah

satu model pembelajaran yang kini banyak

diterapkan didalam kelas secara umum.

Pembelajarankooperatiftidakterbataspada

mata pelajaran tertentu maupun jenjang

pendidikan melainkan untuk semua mata

pelajaran dan jenjang pendidikan. Hal-hal

yang membedakan model pembelajaran

kooperatif tersebutantaradisiplinilmuyang

satudengandisiplinilmulainnyaatauantara

satujenjangpendidikandenganyanglainnya

adalahimplementasinyadidalamkelas.

Model pembelajaran kooperatif

berorientasi kepada teknik pembelajaran

yang bersifat kooperatif atau kerjasama

diantarasesamasiswadalammenyelesaikan

masalah-masalah yang berkaitan dengan

pelajaran yang mereka hadapi. Sistem

penilaian hasil belajar yang diterapkan oleh

guru pada penerapan model pembelajaran

kooperatif tersebut harus pula bersifat

kooperatifdenganmekanismetersendiridan

dirancang secara khusus. Dengan demikian,

keunggulandankelemahanindividutertentu

didalam kelompok tersebut dapat direkam

denganbaik.

PenerapanModelKooperatif

Penerapan model pembelajaran

kooperatifsepertidikemukakanolehIbrahim

dkk (2000:7) bertujuan bukan hanya

membekali siswa dengan pengetahuan

kognitif, afektif dan psikomotorik saja,

melainkan jugamelatih siswa agarmemiliki

sikap toleransi serta mampu menempatkan

dirinya dalam suasana keragaman sosial.

Artinya,siswadididikdandilatihagarmampu

menerimaperbedaanyangterdapatdiantara

mereka selama berlangsungnya kegiatan

belajar mengajar. Implikasi lebih jauh dari

kemampuan menerima perbedaan tersebut

adalah tertanamnya semangat kebersamaan

dalam diri para siswa sebagai bekal untuk

hidupbermasyarakat.

Selain itu, melalui pembelajaran

kooperatif seperti dikemukakan oleh Nur

(2000:8)siswaakanlebihmudahmemahami

konsep-konsep yang sulit jika mereka

mendiskusikan masalah tersebut dengan

temannya. Kegiatan itu, sekaligus juga

melibatkan para siswa dalam suasana real

sehinggamateripelajaranyangdisampaikan

dapat terpatri lebih dalam. Richards

(1995:100)mengemukakanbahwapelibatan

siswa dalam kegiatan pembelajaran akan

membuat mereka belajar memahami suatu

konsep secara mantap. Ia mengutip

pernyataan Benjamin Franklin sebagai

berikut “Tellmeand I forget, teachmeand I

remember, involve me and I learn”. Artinya,

beritahuakuniscayaakuakanmelupakannya,

ajariakuniscayaakuakanmengingatnya,dan

melibatkanakudalamprosesbelajarsehingga

akudapatbelajar.

Orientasi pembelajaran kooperatif

yang menuntut kerjasama penuh di antara

sesama siswa mensyaratkan dibentuknya

kelompok-kelompokkecilyangterdiriatas4

sampai 5 orang siswa. Pembentukan

ke lompok-ke lompok kec i l te rsebut

dimaksudkan untuk memaksimalkan

partisipasi setiap anggota kelompok selama

berlangsungnyaKBMsehinggamerekadapat

dilibatkan dalam proses penyelesaian

masalah.Pelibatanituakanjauhlebihefektif

daripadajikamerekahanyadiberitahusecara

verbal.

Dembo(1988:401)mengemukakan4

teknik pembelajaran yang sangat cocok

diterapkandalampengajarandengansuasana

atau setting kooperatif, yakni Teams-Game-

Tournaments (TGT), Student Team Achieve-

ment Divisions (STAD), Jigsaw, dan Group

Investigation.

Keberhasilan model pendekatan

kooperatif dalam pembelajaran sangat

dipengaruhi oleh kemampuan siswa

berinteraksi antara satu dengan yang lain

dalam setiap kelompok. Oleh karena itu,

diperlukan kiat-kiat tertentu agar pem-

belajaran kooperatif dapat berjalan efektif.

MenurutDembo(1988:403)yangdikutipdari

Johnson et al (1984) ada 4 kiat atau

keterampilan personal dan interpersonal

yang perlu dipersiapkan dengan matang

sehingga kegiatan pembelajaran kooperatif

dapat berjalan sesuai harapan, yakni (1)

kekompakan,(2) partisipasi, (3)formulasi,

dan(4)fermentasi.

Kendala utama yang dihadapi dalam

menerapkanmodelpembelajarankooperatif

adalah kebiasaan belajar anak didik yang

terbiasa dengan model ceramah. Sehingga

ketika model kooperatif diterapkan selain

harusbelajarmaterimatapelajaran,mereka

jugabelajarbagaimanasistemkooperatif.

Pendekatan kooperatif merupakan

model pembelajaran yang dipandang efektif

untukmencapaitargetkurikulumdisatusisi

danprestasidi sisi yang lain.Melaluimodel

pembelajaran kooperatif, beberapa pokok

bahasan atau sub-pokok bahasan dapat

disajikansecarasimultan.Salainitu,prestasi

belajaranakdidikjugadapatlebihditingkat-

kan atas dasar pelibatan mereka secara

partisipatifpenuh.

Pembelajaran kooperatif dapat

dilaksanakan secara efektif apabila siswa

dipersiapkandenganmatangterlebihdahulu

melalui pemberian keterampilan yang

disajikan berdasarkan langkah-langkah

tertentu. Keterampilan tersebut mutlak

diajarkandandilatihkansehinggasiswadapat

menanamkannya ke dalam diri mereka dan

menjadisikapdasardalambelajarkelompok.

Untukmemperolehmasukantentang

sikap yang perlu dimiliki oleh siswa, guru

dapat menyebarkan angket yang berisi

pertanyaan-pertanyaankhusustentangposisi

tertentu yang perlu diterapkan kendatipun

tidak atau belum dicobakan oleh kalangan

tertentu, seperti pertimbangan mengenai

tempattinggalanggotasatukelompok.Halini

berkaitandengankemungkinanadanyatugas

kelompok yang dirancang untuk kegiatan

kookurikuler.

METODEPENELITIAN

Penelitian tindakan kelas ini dilaku-

kanpadabulanJulisampaidenganSeptember

tahun pelajaran 2017/2018. Penelitian ini

dilaksanakandiSMAN3Batamdengansubjek

penelitiankelasX IPA1yang terdiridari35

orang.

Desain penelitian yang digunakan

adalah rancangan Kemmis dan Taggart

(Mukherji, 2010:95) meliputi perencanaan

(plan),tindakan(act),pengamatan(observe),

danre�leksi(re�lect).

Gambar1.Desainpenelitian

Page 39: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

38 39

Bahasa dan Sastra Perancis peserta didik

melalui pengaplikasianmodel pembelajaran

kooperatiftutorsebaya.

KAJIANTEORI

PendekatanKooperatif

Pendekatan kooperatif adalah salah

satu model pembelajaran yang kini banyak

diterapkan didalam kelas secara umum.

Pembelajarankooperatiftidakterbataspada

mata pelajaran tertentu maupun jenjang

pendidikan melainkan untuk semua mata

pelajaran dan jenjang pendidikan. Hal-hal

yang membedakan model pembelajaran

kooperatif tersebutantaradisiplinilmuyang

satudengandisiplinilmulainnyaatauantara

satujenjangpendidikandenganyanglainnya

adalahimplementasinyadidalamkelas.

Model pembelajaran kooperatif

berorientasi kepada teknik pembelajaran

yang bersifat kooperatif atau kerjasama

diantarasesamasiswadalammenyelesaikan

masalah-masalah yang berkaitan dengan

pelajaran yang mereka hadapi. Sistem

penilaian hasil belajar yang diterapkan oleh

guru pada penerapan model pembelajaran

kooperatif tersebut harus pula bersifat

kooperatifdenganmekanismetersendiridan

dirancang secara khusus. Dengan demikian,

keunggulandankelemahanindividutertentu

didalam kelompok tersebut dapat direkam

denganbaik.

PenerapanModelKooperatif

Penerapan model pembelajaran

kooperatifsepertidikemukakanolehIbrahim

dkk (2000:7) bertujuan bukan hanya

membekali siswa dengan pengetahuan

kognitif, afektif dan psikomotorik saja,

melainkan jugamelatih siswa agarmemiliki

sikap toleransi serta mampu menempatkan

dirinya dalam suasana keragaman sosial.

Artinya,siswadididikdandilatihagarmampu

menerimaperbedaanyangterdapatdiantara

mereka selama berlangsungnya kegiatan

belajar mengajar. Implikasi lebih jauh dari

kemampuan menerima perbedaan tersebut

adalah tertanamnya semangat kebersamaan

dalam diri para siswa sebagai bekal untuk

hidupbermasyarakat.

Selain itu, melalui pembelajaran

kooperatif seperti dikemukakan oleh Nur

(2000:8)siswaakanlebihmudahmemahami

konsep-konsep yang sulit jika mereka

mendiskusikan masalah tersebut dengan

temannya. Kegiatan itu, sekaligus juga

melibatkan para siswa dalam suasana real

sehinggamateripelajaranyangdisampaikan

dapat terpatri lebih dalam. Richards

(1995:100)mengemukakanbahwapelibatan

siswa dalam kegiatan pembelajaran akan

membuat mereka belajar memahami suatu

konsep secara mantap. Ia mengutip

pernyataan Benjamin Franklin sebagai

berikut “Tellmeand I forget, teachmeand I

remember, involve me and I learn”. Artinya,

beritahuakuniscayaakuakanmelupakannya,

ajariakuniscayaakuakanmengingatnya,dan

melibatkanakudalamprosesbelajarsehingga

akudapatbelajar.

Orientasi pembelajaran kooperatif

yang menuntut kerjasama penuh di antara

sesama siswa mensyaratkan dibentuknya

kelompok-kelompokkecilyangterdiriatas4

sampai 5 orang siswa. Pembentukan

ke lompok-ke lompok kec i l te rsebut

dimaksudkan untuk memaksimalkan

partisipasi setiap anggota kelompok selama

berlangsungnyaKBMsehinggamerekadapat

dilibatkan dalam proses penyelesaian

masalah.Pelibatanituakanjauhlebihefektif

daripadajikamerekahanyadiberitahusecara

verbal.

Dembo(1988:401)mengemukakan4

teknik pembelajaran yang sangat cocok

diterapkandalampengajarandengansuasana

atau setting kooperatif, yakni Teams-Game-

Tournaments (TGT), Student Team Achieve-

ment Divisions (STAD), Jigsaw, dan Group

Investigation.

Keberhasilan model pendekatan

kooperatif dalam pembelajaran sangat

dipengaruhi oleh kemampuan siswa

berinteraksi antara satu dengan yang lain

dalam setiap kelompok. Oleh karena itu,

diperlukan kiat-kiat tertentu agar pem-

belajaran kooperatif dapat berjalan efektif.

MenurutDembo(1988:403)yangdikutipdari

Johnson et al (1984) ada 4 kiat atau

keterampilan personal dan interpersonal

yang perlu dipersiapkan dengan matang

sehingga kegiatan pembelajaran kooperatif

dapat berjalan sesuai harapan, yakni (1)

kekompakan,(2) partisipasi, (3)formulasi,

dan(4)fermentasi.

Kendala utama yang dihadapi dalam

menerapkanmodelpembelajarankooperatif

adalah kebiasaan belajar anak didik yang

terbiasa dengan model ceramah. Sehingga

ketika model kooperatif diterapkan selain

harusbelajarmaterimatapelajaran,mereka

jugabelajarbagaimanasistemkooperatif.

Pendekatan kooperatif merupakan

model pembelajaran yang dipandang efektif

untukmencapaitargetkurikulumdisatusisi

danprestasidi sisi yang lain.Melaluimodel

pembelajaran kooperatif, beberapa pokok

bahasan atau sub-pokok bahasan dapat

disajikansecarasimultan.Salainitu,prestasi

belajaranakdidikjugadapatlebihditingkat-

kan atas dasar pelibatan mereka secara

partisipatifpenuh.

Pembelajaran kooperatif dapat

dilaksanakan secara efektif apabila siswa

dipersiapkandenganmatangterlebihdahulu

melalui pemberian keterampilan yang

disajikan berdasarkan langkah-langkah

tertentu. Keterampilan tersebut mutlak

diajarkandandilatihkansehinggasiswadapat

menanamkannya ke dalam diri mereka dan

menjadisikapdasardalambelajarkelompok.

Untukmemperolehmasukantentang

sikap yang perlu dimiliki oleh siswa, guru

dapat menyebarkan angket yang berisi

pertanyaan-pertanyaankhusustentangposisi

tertentu yang perlu diterapkan kendatipun

tidak atau belum dicobakan oleh kalangan

tertentu, seperti pertimbangan mengenai

tempattinggalanggotasatukelompok.Halini

berkaitandengankemungkinanadanyatugas

kelompok yang dirancang untuk kegiatan

kookurikuler.

METODEPENELITIAN

Penelitian tindakan kelas ini dilaku-

kanpadabulanJulisampaidenganSeptember

tahun pelajaran 2017/2018. Penelitian ini

dilaksanakandiSMAN3Batamdengansubjek

penelitiankelasX IPA1yang terdiridari35

orang.

Desain penelitian yang digunakan

adalah rancangan Kemmis dan Taggart

(Mukherji, 2010:95) meliputi perencanaan

(plan),tindakan(act),pengamatan(observe),

danre�leksi(re�lect).

Gambar1.Desainpenelitian

Page 40: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

40 41

Penelitianinidilaksanakandalamdua

siklusyangmasing-masingterdiridariempat

tahapan pokok yaitu perencanaan, pelak-

sanaan tindakan, pengamatan dan re�leksi.

Siklus I dilaksanakan dalam 2 (dua) kali

pertemuandenganalokasiwaktupertemuan

masing-masing 3 x 45 menit. Setiap akhir

siklusdiberipost-test.

Tahap perencanaan meliputi telaah

kurikulum, pembuatan RPP yang akan

digunakan, instrumen penelitian dan

pedomannya. Tahap pelaksanaan meliputi

kegiatanyangdilaksanakandikelas.Padasaat

pelaksanaandilakukanjugapengamatanoleh

observer untuk mengamati kegiatan pem-

belajaran yang berlangsung. Setelah pelak-

sanaan berakhir dilakukan re�leksi untuk

melihat kekurangan-kekurangan yang harus

diperbaiki berdasarkan hasil siklus I. Jika

ternyata di siklus I tujuan belum tercapai

makadilaksanakansiklusIIdengantahapan

yangsamasepertisiklusI,tetapisetelahada

perbaikan-perbaikan dari hasil re�leksi. Jika

hasil evaluasi siklus II sudah memenuhi

indikator keberhasilan maka penelitian

dihentikan tetapi jika ternyata hasil belum

memenuhi indikator keberhasilan maka

dapat dilanjutkan ke siklus selanjutnya

denganmempertimbangankan hasil re�leksi

siklusII.

Pengumpulandatadilakukandengan

observasikegiatandantestertulis.Instrumen

penelitian yangdigunakan adalahbutir soal

tes, lembar observasi pembelajaran, diskusi

observerdandokumentasi.

Data tesmerupakan data kuantitatif

yang diambil dari setiap siklus. Observasi

dilakukanuntukmengamatiaktivitaspeserta

didik selama pembelajaran berlangsung. Di

dalamkegiatanobservasi di antaranya akan

melihat proses pembelajaran yang meliputi

peningkatan frekuensi atau kualitas

pertanyaan peserta didik kepada guru

maupun sesama temannya selama interaksi

belajarmengajar,peningkatankerjasama,dan

diskusi kelompok antar pesertadidikdalam

pembelajaran.Dokumentasidigunakandalam

penelitian iniagardapatmerekamperistiwa

penting yang terjadi di kelas pada saat

kegiatanpembelajaranberlangsung.

Hal yang dijadikan parameter atau

penilaian tentang keberhasilan penelitian

tindakan kelas ini adalah adalah jika nilai

diakhir kegiatan penelitian rata-rata kelas

sudahmencapaiKKM75danrata-ratapeserta

didik yang sudah mencapai KKM tersebut

sebesar80%.

HASILPENELITIANDANPEMBAHASAN

HasilPenelitian

Sebelum melaksanakan penelitian,

peneliti menganalisis kondisi awal peserta

didik terhadap pembelajaran Bahasa dan

SastraPerancis.Darikegiatanawaldiperoleh

hanya 20 peserta didik (57,14%) yang

memperolehnilaidiatasKKM,danmasihada

15pesertadidik(42,86%)yangbelumtuntas.

Berdasarkanpermasalahandanhasil

temuan disusun rencana tindakan siklus I

yangdiwujudkandalamRencanaPelaksanaan

Pembelajaran (RPP). Selanjutnya rencana

tindakan siklus I diaplikasikan dalam

pelaksanaan tindakan pembelajaran yang

nyata di kelas dengan melibatkan teman

sejawat sebagai observer dan peneliti

bertindak sebagai guru model. Proses

pembelajaranpadatindakansiklusIdiamati

oleh seorang observer yang bertugas

mencatat seandainya perlu tindakan

selanjutnya. Hasil pengamatan observer

dijadikandasarpenyusunanrencanatindakan

siklusII.HasilbelajarsiswapadasiklusIdapat

dilihatpadaTabelberikut:

Tabel1.HasilBelajarSiklusI

No

Statistik

NilaiStatistik1

2

34567

JumlahPesertaDidik

NilaiTertinggi

NilaiTerendah RentangNilai Rata–rata Median StandarDeviasi

35

95

65 30 81 85

9.299

DatapadaTabeldi atasmenunjukan

bahwa nilai rata-rata hasil belajar siswa

setelah dilakukan model pembelajaran

kooperatifadalah81denganstandardeviasi

9.299 atau 81%dari hasil skor ideal (total)

yangmungkindicapai,yaitu100,sedangkan

skor terendah adalah 65 dari skor minimal

yangmungkindicapaiyakni0(nol).

Jika skor tersebut di atas dikelom-

pokkan ke dalam 5 (lima) kategori, maka

diperoleh distribusi frekuensi nilai seperti

padaTabelberikutini.

Tabel2.DistribusiFrekuensidanPersentaseSkorTesSiklusI

No Skor Katagori Frekuensi Persentase(%)12345

0- 3435 – 54

55– 7475– 84

85– 100

SangatRendah

Rendah

SedangTinggiSangatTinggi

0

0

9 6

20

00

25.7117.1457.14

Jumlah 35 100.00

Data pada Tabel di atas meng-

gambarkanbahwaskorhasilbelajarkosakata

padasiklusIterdapat9orang(25.71%)yang

berada pada kategori sedang dan 6 orang

(17.14%) yang berada pada katagori tinggi.

Sedangkan untuk katagori sangat tinggi 20

orang (57.14%). Jika skor rata-rata hasil

belajarkosakataBahasaPerancis81atau81%

(Tabel1)dikonsultasikandenganTabel2di

atasmaka skor belajarmereka beradapada

interval 75-84. hal ini menunjukan bahwa

hasil belajar siswa setelah pelaksanaan

Kegiatan Belajar Mengajar (KBM) dengan

menerapkanmodelpembelajarankooperatif

mencapaikatagoritinggi.

Setelah dianalisis didapat rata-rata

padasiklusIadalah81.00denganpersentase

ketuntasan74.29%.Meskipunrata-ratatelah

melebihirata-rataKKMyangtelahditetapkan

tetapipersentaseketuntasanbelummencapai

80%, sehinggadiperlukan tindakan lanjutan

padasiklusII.

Pada pertemuan pertama, peneliti

masihmenghadapiberbagaihambatandalam

menyajikan bahan ajar karena kebanyakan

siswabelummampubekerjasamasecaraaktif

dengananggotakelompoknyasendiri.Halitu

dimungkinkan karena kelompok dibentuk

bukanataskemauansiswasendirimelainkan

berdasarkan jenis kelamin dan disparitas

kemampuanakademik.Imbasdariheterogen

anggota kelompok itu adalah banyak siswa

yang ingin dibimbing langsung oleh peneliti

dibandingkan dengan anggota kelompoknya

yanglebihmampu.

Pada pertemuan kedua, siswa sudah

mampu berinteraksi dengan anggota

kelompoknyadalammenghadapaibahanajar

yang disajikan. Bentuk interaksi tersebut

berupakoreksi jika terdapatkesalahanyang

dilakukan oleh salah seorang anggota

kelompok yang mengerjakan soal di papan

tulis.Hanyasajaperubahandimaksudbelum

mencapai taraf yang diinginkan, yakni sikap

demokratis yang tidak hanya bersifat

kelompok,melainkanjugasecaraklasikal.

Berdasarkan re�leksi siklus I dite-

mukan adanya kekurangan dalam RPP dan

pelaksaaan pembelajaran serta belum

tercapainyaindikatorkeberhasilanpenelitian

untuk ketuntasan belajar. Upaya perbaikan

siklus I pada siklus II diperlukan untuk

mengatasi kekurangan siklus I. Rencana

Pelaksanaan Pembelajaran (RPP) disusun

lebihbaik,berkonsultasiulangdenganteman-

teman guru sejawat, merencanakan pem-

Page 41: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

40 41

Penelitianinidilaksanakandalamdua

siklusyangmasing-masingterdiridariempat

tahapan pokok yaitu perencanaan, pelak-

sanaan tindakan, pengamatan dan re�leksi.

Siklus I dilaksanakan dalam 2 (dua) kali

pertemuandenganalokasiwaktupertemuan

masing-masing 3 x 45 menit. Setiap akhir

siklusdiberipost-test.

Tahap perencanaan meliputi telaah

kurikulum, pembuatan RPP yang akan

digunakan, instrumen penelitian dan

pedomannya. Tahap pelaksanaan meliputi

kegiatanyangdilaksanakandikelas.Padasaat

pelaksanaandilakukanjugapengamatanoleh

observer untuk mengamati kegiatan pem-

belajaran yang berlangsung. Setelah pelak-

sanaan berakhir dilakukan re�leksi untuk

melihat kekurangan-kekurangan yang harus

diperbaiki berdasarkan hasil siklus I. Jika

ternyata di siklus I tujuan belum tercapai

makadilaksanakansiklusIIdengantahapan

yangsamasepertisiklusI,tetapisetelahada

perbaikan-perbaikan dari hasil re�leksi. Jika

hasil evaluasi siklus II sudah memenuhi

indikator keberhasilan maka penelitian

dihentikan tetapi jika ternyata hasil belum

memenuhi indikator keberhasilan maka

dapat dilanjutkan ke siklus selanjutnya

denganmempertimbangankan hasil re�leksi

siklusII.

Pengumpulandatadilakukandengan

observasikegiatandantestertulis.Instrumen

penelitian yangdigunakan adalahbutir soal

tes, lembar observasi pembelajaran, diskusi

observerdandokumentasi.

Data tesmerupakan data kuantitatif

yang diambil dari setiap siklus. Observasi

dilakukanuntukmengamatiaktivitaspeserta

didik selama pembelajaran berlangsung. Di

dalamkegiatanobservasi di antaranya akan

melihat proses pembelajaran yang meliputi

peningkatan frekuensi atau kualitas

pertanyaan peserta didik kepada guru

maupun sesama temannya selama interaksi

belajarmengajar,peningkatankerjasama,dan

diskusi kelompok antar pesertadidikdalam

pembelajaran.Dokumentasidigunakandalam

penelitian iniagardapatmerekamperistiwa

penting yang terjadi di kelas pada saat

kegiatanpembelajaranberlangsung.

Hal yang dijadikan parameter atau

penilaian tentang keberhasilan penelitian

tindakan kelas ini adalah adalah jika nilai

diakhir kegiatan penelitian rata-rata kelas

sudahmencapaiKKM75danrata-ratapeserta

didik yang sudah mencapai KKM tersebut

sebesar80%.

HASILPENELITIANDANPEMBAHASAN

HasilPenelitian

Sebelum melaksanakan penelitian,

peneliti menganalisis kondisi awal peserta

didik terhadap pembelajaran Bahasa dan

SastraPerancis.Darikegiatanawaldiperoleh

hanya 20 peserta didik (57,14%) yang

memperolehnilaidiatasKKM,danmasihada

15pesertadidik(42,86%)yangbelumtuntas.

Berdasarkanpermasalahandanhasil

temuan disusun rencana tindakan siklus I

yangdiwujudkandalamRencanaPelaksanaan

Pembelajaran (RPP). Selanjutnya rencana

tindakan siklus I diaplikasikan dalam

pelaksanaan tindakan pembelajaran yang

nyata di kelas dengan melibatkan teman

sejawat sebagai observer dan peneliti

bertindak sebagai guru model. Proses

pembelajaranpadatindakansiklusIdiamati

oleh seorang observer yang bertugas

mencatat seandainya perlu tindakan

selanjutnya. Hasil pengamatan observer

dijadikandasarpenyusunanrencanatindakan

siklusII.HasilbelajarsiswapadasiklusIdapat

dilihatpadaTabelberikut:

Tabel1.HasilBelajarSiklusI

No

Statistik

NilaiStatistik1

2

34567

JumlahPesertaDidik

NilaiTertinggi

NilaiTerendah RentangNilai Rata–rata Median StandarDeviasi

35

95

65 30 81 85

9.299

DatapadaTabeldi atasmenunjukan

bahwa nilai rata-rata hasil belajar siswa

setelah dilakukan model pembelajaran

kooperatifadalah81denganstandardeviasi

9.299 atau 81%dari hasil skor ideal (total)

yangmungkindicapai,yaitu100,sedangkan

skor terendah adalah 65 dari skor minimal

yangmungkindicapaiyakni0(nol).

Jika skor tersebut di atas dikelom-

pokkan ke dalam 5 (lima) kategori, maka

diperoleh distribusi frekuensi nilai seperti

padaTabelberikutini.

Tabel2.DistribusiFrekuensidanPersentaseSkorTesSiklusI

No Skor Katagori Frekuensi Persentase(%)12345

0- 3435 – 54

55– 7475– 84

85– 100

SangatRendah

Rendah

SedangTinggiSangatTinggi

0

0

9 6

20

00

25.7117.1457.14

Jumlah 35 100.00

Data pada Tabel di atas meng-

gambarkanbahwaskorhasilbelajarkosakata

padasiklusIterdapat9orang(25.71%)yang

berada pada kategori sedang dan 6 orang

(17.14%) yang berada pada katagori tinggi.

Sedangkan untuk katagori sangat tinggi 20

orang (57.14%). Jika skor rata-rata hasil

belajarkosakataBahasaPerancis81atau81%

(Tabel1)dikonsultasikandenganTabel2di

atasmaka skor belajarmereka beradapada

interval 75-84. hal ini menunjukan bahwa

hasil belajar siswa setelah pelaksanaan

Kegiatan Belajar Mengajar (KBM) dengan

menerapkanmodelpembelajarankooperatif

mencapaikatagoritinggi.

Setelah dianalisis didapat rata-rata

padasiklusIadalah81.00denganpersentase

ketuntasan74.29%.Meskipunrata-ratatelah

melebihirata-rataKKMyangtelahditetapkan

tetapipersentaseketuntasanbelummencapai

80%, sehinggadiperlukan tindakan lanjutan

padasiklusII.

Pada pertemuan pertama, peneliti

masihmenghadapiberbagaihambatandalam

menyajikan bahan ajar karena kebanyakan

siswabelummampubekerjasamasecaraaktif

dengananggotakelompoknyasendiri.Halitu

dimungkinkan karena kelompok dibentuk

bukanataskemauansiswasendirimelainkan

berdasarkan jenis kelamin dan disparitas

kemampuanakademik.Imbasdariheterogen

anggota kelompok itu adalah banyak siswa

yang ingin dibimbing langsung oleh peneliti

dibandingkan dengan anggota kelompoknya

yanglebihmampu.

Pada pertemuan kedua, siswa sudah

mampu berinteraksi dengan anggota

kelompoknyadalammenghadapaibahanajar

yang disajikan. Bentuk interaksi tersebut

berupakoreksi jika terdapatkesalahanyang

dilakukan oleh salah seorang anggota

kelompok yang mengerjakan soal di papan

tulis.Hanyasajaperubahandimaksudbelum

mencapai taraf yang diinginkan, yakni sikap

demokratis yang tidak hanya bersifat

kelompok,melainkanjugasecaraklasikal.

Berdasarkan re�leksi siklus I dite-

mukan adanya kekurangan dalam RPP dan

pelaksaaan pembelajaran serta belum

tercapainyaindikatorkeberhasilanpenelitian

untuk ketuntasan belajar. Upaya perbaikan

siklus I pada siklus II diperlukan untuk

mengatasi kekurangan siklus I. Rencana

Pelaksanaan Pembelajaran (RPP) disusun

lebihbaik,berkonsultasiulangdenganteman-

teman guru sejawat, merencanakan pem-

Page 42: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

42 43

belajaranyangtepatsesuaimodelkooperatif.

Deskripsi secara kuantitatif hasil

belajarsiswaberdasarkantesSiklusIIyakni

setelah diadakan perbaikan-perbaikan dan

penyempurnaankegiatanyanganggapkurang

padasiklusIdapatdilihatpadaTabelberikut

ini.

Tabel3.HasilBelajarSiklusII

No

Statistik

NilaiStatistik

1

2

3456

7

JumlahPesertaDidik

NilaiTertinggi

NilaiTerendah RentangNilaiRata– rataMedian

StandarDeviasi

35

100

53.55 46.45 88.88 92.82

12.149

DatapadaTabel di atasmenunjukan

bahwanilairata-rataperolehansiswasetelah

diadakan tindakan lanjutan adalah 88.88

dengan standar deviasi 12.149 atau 88.88%

dan skor ideal (total) yangmungkin dicapai

yakni 100, sedangkan skor terendah adalah

53.55dariskorminimalyangmungkindicapai

yakni 0. Hal inimenunjukkan bahwa secara

klasikal hasil belajar kosakata Bahasa

PerancisyangdiperolehpadaSiklusIIadalah

88.88%. sedangkan secara individual skor

yang dicapai tersebar antara 53.55 sebagai

skorterendahdan100sebagaiskortertinggi

ataudalamrentangnilai46.45.kenyataanini

menggambarkan bahwa hasil belajar siswa

KelasXIPA1SMAN3Batamcukupbervariasi.

Jika skor perolehan siswa tersebut

dikelompokkan ke dalam 5 katagori, maka

diperoleh distribusi frekuensi nilai sebagai

berikut.

Tabel4.DistribusiFrekuensidanPersentaseSkorTesSiklusII

Tabeldiatasmenunjukanbahwahasil

belajarkosakataBahasaPerancispadasiklus

2 terdapat6orang(17.14%)yangmencapai

katagori tinggidan25orang (71.43%)yang

beradapadakatagorisangattinggi.Skorrata-

rata hasil belajar kosakata Bahasa Perancis

adalah 88.88 atau 88.88% (Tabel 3), yaitu

beradapada interval85-100 hal iniberarti

bahwa hasil belajar siswa setelah diadakan

KBM dengan menerapkan model pem-

belajaran kooperatif berada pada katagori

sangattinggi.

Berdasarkan analisis yang telah

dilakukan,terlihatbahwaterjadipeningkatan

prestasibelajarpesertadidikjikadibanding-

kandengansiklusI.Dari35pesertadidik,31

orang telah memenuhi kriteria ketuntasan

dan4orangyangharusmengikutiremedial.

Nilai peserta didik yang terbanyak muncul

adalah 85–100, dengan persentase

ketuntasanuntuksiklusII mencapai88.57%

dan rata-rata 88.88. Hasil analisis ini

menggambarkan bahwa prestasi belajar

peserta didik sudah mencapai indikator

keberhasilan penelitian, yaitu minimal 80%

peserta didik mencapai nilai sesuai KKM

meskipunmasihadapesertadidikyangharus

mengikutiremedial.

Gra�ik berikut memperlihatkan

peningkatan hasil belajar kosakata Bahasa

Perancisdaripra-siklus,siklusIsampaisiklus

IImodelpembelajarankooperatif.

Gra�ik1.PeningkatanhasilbelajarkosakataBahasaPerancis

No Skor Katagori Frekuensi Persentase(%)12345

0- 34

35 – 54

55– 7475– 84 85– 100

SangatRendah

Rendah

SedangTinggiSangatTinggi

1

1

2 6 25

2.862.865.7117.1471.43

Jumlah 35 100.00

Dari gra�ik tersebut dapat dipahami

bahwanilairata-rataperolehansiswadarites

pra-siklus, siklus I dan siklus II terdapat

peningkatan. Hal ini berarti terjadi

peningkatan kemampuan siswa dalam

menyelesaikan soal-soal yang berhubungan

denganpenguasaankosakataBahasaPerancis

setelahmelaluimodelpembejarankooperatif.

Di samping terjadinya kemampuan

siswa dalam menyelesaikan soal-soal yang

berhubungan dengan penguasaan kosakata

BahasaPerancisselamaprosespembelajaran

yakni siklus I dan II, tercatat pula sejumlah

perubahan yang terjadi pada sikap siswa

terhadap pelajaran Bahasa Perancis itu

sendiri.Perubahantersebutmerupakandata

kuantitatif yang diperoleh dari kegiatan

observasipadasetiappertemuanyangdicatat

padasetiapsiklus.

Pembahasan

Dalam pelaksanaan tindakan selama

siklus I berlangsung tercatat sejumlah

perubahansikappadadirisiswa,yaitu:

1. Pada pertemuan awal kehadiran siswa

mengikuti kegiatan belajar masih sama

seperti sebelum pelaksanaan tindakan,

tetapi pada akhir siklus terjadi

peningkatan.

2.Keberaniansiswamengajukanpertanyaan

dan menanggap i j awaban yang

dikemukakan oleh siswa lain semakin

meningkat.Demikianpulahalnyadengan

respon siswa terhadap pertanyaan yang

dikemukakanolehguru.

3. Kemampuan siswa menyelesaikan soal-

soal yang diberikan untuk diselesaikan

secara individu juga meningkat yang

dapat ditandai dengan kurangnya siswa

yang terlambat atau tidak mengerjakan

tugas.

Pada Siklus II tercatat pula sejumlah

perubahanpentingpadadirisiswayangdapat

dirangkumsebagaiberikut:

1. Prestasibelajarsiswasemakinmeningkat

yangditandaidengansemakinbanyaknya

yang dapat memperoleh skor dengan

katagorisangattinggi.

2. Rasa percaya diri siswa jugamengalami

peningkatan yang signi�ikan dengan

kerapnya memberikan respon terhadap

jawaban kelompok lain yang cenderung

berbedadarijawabananggotakelompok

lain.

3. Semangatkerjasamadansikapdemokrasi

juga sering ditunjukan oleh anggota

kelompok yang ditandai dengan

pemberian kesempatan kepada setiap

anggota kelompok untuk mengajukan

pertanyaan atau memberikan respon

terhadap pertanyaan yang dikemukakan

olehgurumaupunolehanggotakelompok

lain.

Pada umumnya siswa menganggap

bahwa model pembelajaran kooperatif jauh

lebih baik daripada pendekatan yang

diterapkansebelumnya.Soal-soalyangtidak

dapat diselesaikan secara mandiri dapat

diselesaikanmelalui kelompok dan dengan

waktuyangjauhlebihsingkat.

Pembentukan kelompok yang

mengacukepadaperbedaanjeniskelamindan

disparitas kemampuan akademik ternyata

mampumeminimalkansekat-sekatkelompok

yang ada. Dengan pembentukan kelompok

seperti itu, banyak siswa yang baru dapat

mengenal karakter, sikap, dan kemampuan

temannya secara lebih dekat. Artinya, sikap

kebersamaandalamsatukelasmenjadilebih

utuh karena adanya perbedaan anggota

kelompokbelajardengananggotakelompok

bermaindiluarjampelajaran.

Page 43: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

42 43

belajaranyangtepatsesuaimodelkooperatif.

Deskripsi secara kuantitatif hasil

belajarsiswaberdasarkantesSiklusIIyakni

setelah diadakan perbaikan-perbaikan dan

penyempurnaankegiatanyanganggapkurang

padasiklusIdapatdilihatpadaTabelberikut

ini.

Tabel3.HasilBelajarSiklusII

No

Statistik

NilaiStatistik

1

2

3456

7

JumlahPesertaDidik

NilaiTertinggi

NilaiTerendah RentangNilaiRata– rataMedian

StandarDeviasi

35

100

53.55 46.45 88.88 92.82

12.149

DatapadaTabel di atasmenunjukan

bahwanilairata-rataperolehansiswasetelah

diadakan tindakan lanjutan adalah 88.88

dengan standar deviasi 12.149 atau 88.88%

dan skor ideal (total) yangmungkin dicapai

yakni 100, sedangkan skor terendah adalah

53.55dariskorminimalyangmungkindicapai

yakni 0. Hal inimenunjukkan bahwa secara

klasikal hasil belajar kosakata Bahasa

PerancisyangdiperolehpadaSiklusIIadalah

88.88%. sedangkan secara individual skor

yang dicapai tersebar antara 53.55 sebagai

skorterendahdan100sebagaiskortertinggi

ataudalamrentangnilai46.45.kenyataanini

menggambarkan bahwa hasil belajar siswa

KelasXIPA1SMAN3Batamcukupbervariasi.

Jika skor perolehan siswa tersebut

dikelompokkan ke dalam 5 katagori, maka

diperoleh distribusi frekuensi nilai sebagai

berikut.

Tabel4.DistribusiFrekuensidanPersentaseSkorTesSiklusII

Tabeldiatasmenunjukanbahwahasil

belajarkosakataBahasaPerancispadasiklus

2 terdapat6orang(17.14%)yangmencapai

katagori tinggidan25orang (71.43%)yang

beradapadakatagorisangattinggi.Skorrata-

rata hasil belajar kosakata Bahasa Perancis

adalah 88.88 atau 88.88% (Tabel 3), yaitu

beradapada interval85-100 hal iniberarti

bahwa hasil belajar siswa setelah diadakan

KBM dengan menerapkan model pem-

belajaran kooperatif berada pada katagori

sangattinggi.

Berdasarkan analisis yang telah

dilakukan,terlihatbahwaterjadipeningkatan

prestasibelajarpesertadidikjikadibanding-

kandengansiklusI.Dari35pesertadidik,31

orang telah memenuhi kriteria ketuntasan

dan4orangyangharusmengikutiremedial.

Nilai peserta didik yang terbanyak muncul

adalah 85–100, dengan persentase

ketuntasanuntuksiklusII mencapai88.57%

dan rata-rata 88.88. Hasil analisis ini

menggambarkan bahwa prestasi belajar

peserta didik sudah mencapai indikator

keberhasilan penelitian, yaitu minimal 80%

peserta didik mencapai nilai sesuai KKM

meskipunmasihadapesertadidikyangharus

mengikutiremedial.

Gra�ik berikut memperlihatkan

peningkatan hasil belajar kosakata Bahasa

Perancisdaripra-siklus,siklusIsampaisiklus

IImodelpembelajarankooperatif.

Gra�ik1.PeningkatanhasilbelajarkosakataBahasaPerancis

No Skor Katagori Frekuensi Persentase(%)12345

0- 34

35 – 54

55– 7475– 84 85– 100

SangatRendah

Rendah

SedangTinggiSangatTinggi

1

1

2 6 25

2.862.865.7117.1471.43

Jumlah 35 100.00

Dari gra�ik tersebut dapat dipahami

bahwanilairata-rataperolehansiswadarites

pra-siklus, siklus I dan siklus II terdapat

peningkatan. Hal ini berarti terjadi

peningkatan kemampuan siswa dalam

menyelesaikan soal-soal yang berhubungan

denganpenguasaankosakataBahasaPerancis

setelahmelaluimodelpembejarankooperatif.

Di samping terjadinya kemampuan

siswa dalam menyelesaikan soal-soal yang

berhubungan dengan penguasaan kosakata

BahasaPerancisselamaprosespembelajaran

yakni siklus I dan II, tercatat pula sejumlah

perubahan yang terjadi pada sikap siswa

terhadap pelajaran Bahasa Perancis itu

sendiri.Perubahantersebutmerupakandata

kuantitatif yang diperoleh dari kegiatan

observasipadasetiappertemuanyangdicatat

padasetiapsiklus.

Pembahasan

Dalam pelaksanaan tindakan selama

siklus I berlangsung tercatat sejumlah

perubahansikappadadirisiswa,yaitu:

1. Pada pertemuan awal kehadiran siswa

mengikuti kegiatan belajar masih sama

seperti sebelum pelaksanaan tindakan,

tetapi pada akhir siklus terjadi

peningkatan.

2.Keberaniansiswamengajukanpertanyaan

dan menanggap i j awaban yang

dikemukakan oleh siswa lain semakin

meningkat.Demikianpulahalnyadengan

respon siswa terhadap pertanyaan yang

dikemukakanolehguru.

3. Kemampuan siswa menyelesaikan soal-

soal yang diberikan untuk diselesaikan

secara individu juga meningkat yang

dapat ditandai dengan kurangnya siswa

yang terlambat atau tidak mengerjakan

tugas.

Pada Siklus II tercatat pula sejumlah

perubahanpentingpadadirisiswayangdapat

dirangkumsebagaiberikut:

1. Prestasibelajarsiswasemakinmeningkat

yangditandaidengansemakinbanyaknya

yang dapat memperoleh skor dengan

katagorisangattinggi.

2. Rasa percaya diri siswa jugamengalami

peningkatan yang signi�ikan dengan

kerapnya memberikan respon terhadap

jawaban kelompok lain yang cenderung

berbedadarijawabananggotakelompok

lain.

3. Semangatkerjasamadansikapdemokrasi

juga sering ditunjukan oleh anggota

kelompok yang ditandai dengan

pemberian kesempatan kepada setiap

anggota kelompok untuk mengajukan

pertanyaan atau memberikan respon

terhadap pertanyaan yang dikemukakan

olehgurumaupunolehanggotakelompok

lain.

Pada umumnya siswa menganggap

bahwa model pembelajaran kooperatif jauh

lebih baik daripada pendekatan yang

diterapkansebelumnya.Soal-soalyangtidak

dapat diselesaikan secara mandiri dapat

diselesaikanmelalui kelompok dan dengan

waktuyangjauhlebihsingkat.

Pembentukan kelompok yang

mengacukepadaperbedaanjeniskelamindan

disparitas kemampuan akademik ternyata

mampumeminimalkansekat-sekatkelompok

yang ada. Dengan pembentukan kelompok

seperti itu, banyak siswa yang baru dapat

mengenal karakter, sikap, dan kemampuan

temannya secara lebih dekat. Artinya, sikap

kebersamaandalamsatukelasmenjadilebih

utuh karena adanya perbedaan anggota

kelompokbelajardengananggotakelompok

bermaindiluarjampelajaran.

Page 44: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

44 45

Beberapa orang siswa memberikan

tanggapan terhadap pekerjaan rumah yang

diberikan hampir setiap akhir pertemuan.

Mereka menginginkan agar jumlah soal

dikurangi karena mata pelajaran lain juga

memberikanpekerjaanrumahdenganjumlah

soal yang relatif samabanyaknya. Selain itu,

siswa juga mengkritik beberapa kebijakan

guruyangdianggapberatsebelahkarenaada

kelompokyangseringdibimbing,sedangkan

kelompok mereka “cenderung” dibiarkan

berjalan dan menyelesaikan sendiri tugas-

tugasyangdiberikan.

SIMPULANDANSARAN

Simpulan

Berdasarkan temuan-temuan yang

diperolehmelaluipenelitiantindakankelasini

maka dapat disimpulkan bahwa: 1) Model

Pembelajaran Kooperatif (Cooperative

Learning) dalam mata pelajaran Bahasa

Perancis dapat meningkatkan baik prestasi

akademikataukognitifmaupunketerampilan

sosial s iswa (afekti f ) . Peningkatan

kemampuan kognitif tersebut dapat dilihat

padapeningkatanhasilbelajaryangsigni�ikan

antarasiklusI denganSiklusIIataudarinilai

rata-rata 81.00 dengan ketuntasan 74.29%

pada siklus I menjadi 88.88 dengan

ketuntasan88.57%padasiklus II;2)Secara

kualitatif terjadi perubahan sikap siswa

denganmelakukan kegiatan-kegiatan positif

berupapeningkatanperhatian,motivasi,dan

minat siswa terhadap pelajaran Bahasa

Perancis; dan 3) Sikap demokratis dan juga

kerjasama siswamenjadi lebih baik dengan

semakin minimnya sekat-sekat kelompok

sepertiyangadasebelumpelaksanaanModel

PembelajaranKooperatif.

Saran

Dari kesimpulan di atas penulis

memberikan saran: 1) Implementasi

pendekatan kooperatif dalam pembelajaran

menuntut fasilitas belajar yang optimal

terutama buku-buku acuan sebagai sumber

rujukan dalam mencari solusi dari

permasalahanyangdiberikanolehguru;dan

2) Pihak sekolah serta lembaga-lembaga

terkai t la innya sangat d iharapkan

berpartisipasidalammenimimalkanmasalah

yang berhubungan dengan fasil itas

pembelajaran.

DaftarPustaka

Dembo,MyronH.1988.ApplyingEducationalPsychologyintheClassroom.London:LongmanLtd.

Ibrahim, Muslimin,dkk.2000.PembelajaranKo o p e r a t i f , P u s a t S a i n s d a nMatematika Sekolah . Surabaya :ProgramPascaSarjanaUnesa.

Nur,Muhammad.2000.PengajaranBerpusatke l ada S i swa dan Pendeka tanKonstruktivis dalam Pengajaran .Surabaya : Pusat Studi Matematika

dan IPA Sekolah Universitas NegeriSurabaya.

Richards, Jack C and Rodgers, Theodore S.1995. Approaches and Methods inLanguage Teaching. Melbourne :CambridgeUniversitasPress.

Mukherji, Penny and Deborah Albon. 2010.ResearchMethods inEarlyChildhood:AnIntroductoryGuide.London:SAGEPublicationsInc.

UPAYAMEMOTIVASIMINATBACASISWADENGANPENDEKATANKECEPATANDANKECERMATANBACA(KKB)DIKELASVBSEMESTERISDN001BATAMKOTA,KOTABATAM

TAHUNPELAJARAN2018/2019

HenyHarini*

Abstrak:TujuandaripenelitianiniadalahuntukpeningkatanprestasibelajardanmotivasibelajarBahasa

Indonesia setelah diterapkannya penggunaan model pendekatan KKB. Penelitian ini menggunakan

penelitiantindakankelas(actionresearch)dilakukansebanyaktigasiklus.Setiapsiklusterdiridariempat

tahapyaitu:rancangan,kegiatandanpengamatan,re�leksi,danrevisi.Subyekpenelitianiniadalahsiswa

kelasVBSDNegeri001BatamKota.Datayangdiperolehberupahasiltesformatif,lembarobservasikegiatan

belajarmengajar.Darihasilanalisisdidapatkanbahwaprestasibelajarsiswamengalamipeningkatandari

siklusIsampaisiklusIIyaitu,siklusI(66,67%)siklusII(69,17%)dansiklusIII(78,33%).Simpulandari

penelitianiniadalahpenggunaanmodelpendekatanKecepatandanKecermatanBacadapatberpengaruh

positifterhadapprestasi,minat,perhatiandanpartipasi,motivasibelajarSiswaSDN001BatamKota,serta

modelpembelajaraninidapatdigunakansebagaisalahsatualternatifpembelajaranBahasaIndonesia.

Katakunci:Motivasi,PendekatanKKB

PENDAHULUAN

Bahasamemiliki peran sentral dalam

perkembangan intelektual, sosial, dan

emosional peserta didik dan merupakan

penunjang keberhasilan dalam mempelajari

semua bidang studi. Pembelajaran bahasa

diharapkan membantu peserta didik

mengenal dirinya, budayanya, dan budaya

orang lain, mengemukakan gagasan dan

perasaan, berpartisipasi dalam masyarakat

yang menggunakan bahasa tersebut, dan

menemukansertamenggunakankemampuan

analistis dan imaginatif yang ada dalam

dirinya.

Pembelajaran Bahasa Indonesia di-

arahkan untuk meningkatkan kemampuan

peserta didik untuk berkomunikasi dalam

bahasaIndonesiadenganbaikdanbenar.Baik

secara lisan maupun tulisan, serta me-

numbuhkan apresiasi terhadap hasil karya

kesusasteraanmanusia Indonesia. Selain hal

tersebut diatas kelancaran berbahasa me-

rupakan dasar bagi peserta didik untuk

memahami dan merespon situasi lokal,

nasional, maupun global dimana per-

kembangan informasi dan teknologi yang

semakin canggih. Hal ini menuntut peserta

didik untuk berusaha mengejarnya melalui

proses pembelajaran bahasa Indonesia

khususnya pada aspek membaca (membaca

cepat). Namun pada kenyataannya peserta

didik belum berhasil dengan baik dalam

pembelajaranmembacacepatdan tentusaja

akan sulit memenuhi tuntutan zaman yang

serba canggih ini. Karena menurut pe-

ngamatan penulis selama menyampaikan

prosespembelajaranbahasaIndonesiakurang

lebih satu semester hampir setiap proses

pembelajaran tentang membaca cepat,

peserta didik kurang maksimal dalam

menerima materi pelajaran. Bahkan sering

terkesan asyik sendiri tanpa mempedulikan

apayangdisampaikanolehguru.Haliniterjadi

hampirdisemuakelas.Salahsatunyaadalah

kelasVBdiSekolahDasarNegeri001Batam

Kota.

Mengapadisekolahyangsama,tingkat

kelas yang sama, dengan guru yang sama

terjadi kesenjangan nilai antara kelas VA

Page 45: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

44 45

Beberapa orang siswa memberikan

tanggapan terhadap pekerjaan rumah yang

diberikan hampir setiap akhir pertemuan.

Mereka menginginkan agar jumlah soal

dikurangi karena mata pelajaran lain juga

memberikanpekerjaanrumahdenganjumlah

soal yang relatif samabanyaknya. Selain itu,

siswa juga mengkritik beberapa kebijakan

guruyangdianggapberatsebelahkarenaada

kelompokyangseringdibimbing,sedangkan

kelompok mereka “cenderung” dibiarkan

berjalan dan menyelesaikan sendiri tugas-

tugasyangdiberikan.

SIMPULANDANSARAN

Simpulan

Berdasarkan temuan-temuan yang

diperolehmelaluipenelitiantindakankelasini

maka dapat disimpulkan bahwa: 1) Model

Pembelajaran Kooperatif (Cooperative

Learning) dalam mata pelajaran Bahasa

Perancis dapat meningkatkan baik prestasi

akademikataukognitifmaupunketerampilan

sosial s iswa (afekti f ) . Peningkatan

kemampuan kognitif tersebut dapat dilihat

padapeningkatanhasilbelajaryangsigni�ikan

antarasiklusI denganSiklusIIataudarinilai

rata-rata 81.00 dengan ketuntasan 74.29%

pada siklus I menjadi 88.88 dengan

ketuntasan88.57%padasiklus II;2)Secara

kualitatif terjadi perubahan sikap siswa

denganmelakukan kegiatan-kegiatan positif

berupapeningkatanperhatian,motivasi,dan

minat siswa terhadap pelajaran Bahasa

Perancis; dan 3) Sikap demokratis dan juga

kerjasama siswamenjadi lebih baik dengan

semakin minimnya sekat-sekat kelompok

sepertiyangadasebelumpelaksanaanModel

PembelajaranKooperatif.

Saran

Dari kesimpulan di atas penulis

memberikan saran: 1) Implementasi

pendekatan kooperatif dalam pembelajaran

menuntut fasilitas belajar yang optimal

terutama buku-buku acuan sebagai sumber

rujukan dalam mencari solusi dari

permasalahanyangdiberikanolehguru;dan

2) Pihak sekolah serta lembaga-lembaga

terkai t la innya sangat d iharapkan

berpartisipasidalammenimimalkanmasalah

yang berhubungan dengan fasil itas

pembelajaran.

DaftarPustaka

Dembo,MyronH.1988.ApplyingEducationalPsychologyintheClassroom.London:LongmanLtd.

Ibrahim, Muslimin,dkk.2000.PembelajaranKo o p e r a t i f , P u s a t S a i n s d a nMatematika Sekolah . Surabaya :ProgramPascaSarjanaUnesa.

Nur,Muhammad.2000.PengajaranBerpusatke l ada S i swa dan Pendeka tanKonstruktivis dalam Pengajaran .Surabaya : Pusat Studi Matematika

dan IPA Sekolah Universitas NegeriSurabaya.

Richards, Jack C and Rodgers, Theodore S.1995. Approaches and Methods inLanguage Teaching. Melbourne :CambridgeUniversitasPress.

Mukherji, Penny and Deborah Albon. 2010.ResearchMethods inEarlyChildhood:AnIntroductoryGuide.London:SAGEPublicationsInc.

UPAYAMEMOTIVASIMINATBACASISWADENGANPENDEKATANKECEPATANDANKECERMATANBACA(KKB)DIKELASVBSEMESTERISDN001BATAMKOTA,KOTABATAM

TAHUNPELAJARAN2018/2019

HenyHarini*

Abstrak:TujuandaripenelitianiniadalahuntukpeningkatanprestasibelajardanmotivasibelajarBahasa

Indonesia setelah diterapkannya penggunaan model pendekatan KKB. Penelitian ini menggunakan

penelitiantindakankelas(actionresearch)dilakukansebanyaktigasiklus.Setiapsiklusterdiridariempat

tahapyaitu:rancangan,kegiatandanpengamatan,re�leksi,danrevisi.Subyekpenelitianiniadalahsiswa

kelasVBSDNegeri001BatamKota.Datayangdiperolehberupahasiltesformatif,lembarobservasikegiatan

belajarmengajar.Darihasilanalisisdidapatkanbahwaprestasibelajarsiswamengalamipeningkatandari

siklusIsampaisiklusIIyaitu,siklusI(66,67%)siklusII(69,17%)dansiklusIII(78,33%).Simpulandari

penelitianiniadalahpenggunaanmodelpendekatanKecepatandanKecermatanBacadapatberpengaruh

positifterhadapprestasi,minat,perhatiandanpartipasi,motivasibelajarSiswaSDN001BatamKota,serta

modelpembelajaraninidapatdigunakansebagaisalahsatualternatifpembelajaranBahasaIndonesia.

Katakunci:Motivasi,PendekatanKKB

PENDAHULUAN

Bahasamemiliki peran sentral dalam

perkembangan intelektual, sosial, dan

emosional peserta didik dan merupakan

penunjang keberhasilan dalam mempelajari

semua bidang studi. Pembelajaran bahasa

diharapkan membantu peserta didik

mengenal dirinya, budayanya, dan budaya

orang lain, mengemukakan gagasan dan

perasaan, berpartisipasi dalam masyarakat

yang menggunakan bahasa tersebut, dan

menemukansertamenggunakankemampuan

analistis dan imaginatif yang ada dalam

dirinya.

Pembelajaran Bahasa Indonesia di-

arahkan untuk meningkatkan kemampuan

peserta didik untuk berkomunikasi dalam

bahasaIndonesiadenganbaikdanbenar.Baik

secara lisan maupun tulisan, serta me-

numbuhkan apresiasi terhadap hasil karya

kesusasteraanmanusia Indonesia. Selain hal

tersebut diatas kelancaran berbahasa me-

rupakan dasar bagi peserta didik untuk

memahami dan merespon situasi lokal,

nasional, maupun global dimana per-

kembangan informasi dan teknologi yang

semakin canggih. Hal ini menuntut peserta

didik untuk berusaha mengejarnya melalui

proses pembelajaran bahasa Indonesia

khususnya pada aspek membaca (membaca

cepat). Namun pada kenyataannya peserta

didik belum berhasil dengan baik dalam

pembelajaranmembacacepatdan tentusaja

akan sulit memenuhi tuntutan zaman yang

serba canggih ini. Karena menurut pe-

ngamatan penulis selama menyampaikan

prosespembelajaranbahasaIndonesiakurang

lebih satu semester hampir setiap proses

pembelajaran tentang membaca cepat,

peserta didik kurang maksimal dalam

menerima materi pelajaran. Bahkan sering

terkesan asyik sendiri tanpa mempedulikan

apayangdisampaikanolehguru.Haliniterjadi

hampirdisemuakelas.Salahsatunyaadalah

kelasVBdiSekolahDasarNegeri001Batam

Kota.

Mengapadisekolahyangsama,tingkat

kelas yang sama, dengan guru yang sama

terjadi kesenjangan nilai antara kelas VA

Page 46: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

46 47

dengan kelas VB. Tingkat pencapaian

pembelajaran biasanya dinyatakan dengan

nilai.Pembelajarandikatakanberhasilapabila

nilai rata-rata dari hasil ulangan telah

mencapaitargetlebihdari70%.Berdasarkan

hasil ulangan harian mata pelajaran bahasa

Indonesia (membaca cepat) siswa kelas VB

SDN001BatamKotahanya18dari33siswa

yang mencapai 70% keatas. Artinya 55%

s iswa yang baru mencapai t ingkat

keberhasilan. Sedangkan di kelas VA ada 29

dari 35 siswa yang telah mencapai tingkat

penguasaanmateri70%keatas.Atau91,63%

telah mencapai tingkat penguasaan materi

70% keatas. Menurut penulis, masalah ini

perlu dicari solusinya. Tujuan Penulisan

tujuan dari penelitian ini adalah untuk

peningkatanprestasibelajardanmotivasi

belajar Bahasa Indonesia setelah di-

terapkannya penggunaan model pen-

dekatanKKB.

Menurutpengalamanpenulis selama

lebihkurangsatusemester,pelajaranBahasa

Indonesia ( membaca cepat ) di kelas VB

kurang memuaskan. Bahkan memasuki

semester II ini, meskipun sudah diadakan

ulangan satu kali oleh penulis belum juga

berhasildenganbaik.Dari34siswakelasVB,

18siswayangmencapaitingkatkeberhasilan

75%keatas.Berdasarkanpengamatanpenulis

selama pembelajaran berlangsung siswa

kurang maksimal dan kurang merespon

terhadapmateri yangdiberikan.Adakalanya

suasanakelasributtidakmenentubahkanada

sebagiansiswayangasyiksendiri.

Berdasarkan beberapa temuan pe-

nulis mengidenti�ikasi masalah yang terjadi

dalampembelajaran:1)Siswakurangmem-

perhatikanpelajaranyangdiberikan;2)Siswa

menemuibeberapakesulitandalammembaca

cepat; 3) Metode pembelajaran yang

cenderung monoton; 4) Siswa kurang

maksimaldalammenerimamateripelajaran;

5) Alat peraga yang digunakan cenderung

kurangmendukung.

Berdasarkananalisis Identi�ikasima-

salah, penulis memfokuskan perbaikan

“MemotivasiMinatBacaSiswa“

PEMBAHASANMASALAH

Faktor membaca merupakan bagian

yang sangat penting dalam pengembangan

kompetensi dasar yang menjadi arah dan

landasan untuk mengembangkan bakat dan

kemampuan berbahasa sebagai pertim-

bangan bahwa individu itu lahir belum

mampu berbahasa, baik dalam kebiasaan,

cita-cita,sikap,pengetahuan,ketrampilandan

sebagainya.Kesemuanya itudapatdiperoleh

individu melalui interaksi dengan keluarga,

masyarakat sekitar, dan tentu saja dengan

bersekolah.Sekolahmempunyaitugaskhusus

untukmembagipengalamankepadasiswanya

denganbermacamcara.Salahsatunyaadalah

melalui pembelajaran Bahasa Indonesia

dengan “Memotivasi Minat Baca Siswa (

M2BS)”. Dilihat dari masalah yang dihadapi

siswa kelas VB apabila seseorang tidak

maksimal dalam mempelajari sesuatu hal,

tentu tidak dapat diharapkan dia akan

berhasildenganbaik.

Sebaiknya jika seseorang belajar

dengansungguh-sungguhdanmaksimalserta

mampumenerapkanbagaimanamemotivasi

minatbacakhususnyadalammembacacepat,

makadapatdiharapkanbahwahasilnyaakan

lebihbaik.Sebelummembahasstrategiuntuk

memotivasiminatbacakhususnyamembaca

cepat, terlebih dahulu penulis ingin me-

maparkan tentang adanya perubahan

paradigm pengajaran (Pembelajaran dan

ProsesBelajar(learning)DewiSalmaP.2000

dalam buku Pembaharuan Pembelajaran).

Adapunmaknadariparadigmaituantaralain:

1) Paradigma Pengajaran diartikan bahwa

pendidikanhanyaterjadidisekolah.Dimana

sudahadaguruyangmengajar.Gurusebagai

satu-satunya narasumber yang akan men-

transfer ilmu. Dalam proses pembelajaran,

guruberperansebagaipenyajimateri.Artinya

siswa hanya menyimak dan mengerjakan

tugas yang diberikan oleh guru. Guru tidak

melibatkan peran aktif siswa; 2) Paradigma

Pembelajaran diartikan lebih memberi

perhatiankepadasiswa.Dalampembelajaran

ini guru tidak hanya sebagai satu-satunya

narasumberdantidakhanyasebagaipengajar,

namun juga sebagai fasilitator yang

membantu siswa belajar. Komunikasi dan

pendekatan system mulai diterapkan.

Penerapan pendekatan system yaitu guru

sebagai sub system berperan dalam

merancang, mengolah dan menilai proses

pembelajaran. Penerapan Strategi “ M2BS “

denganpendekatan “KKB “ sebagai sumber

dan guru sebagai fasilitator; 3) Paradigma

proses belajar (learning) dimaksudkan agar

lebih menggali segala aspek belajar mulai

perencanaan konsep yang diawali dengan

bersifatkongkrit(nyata)sampaiyangbersifat

abstrak(tidaknyata).

Dari tiga paradigma diatas penulis

mengembangkanparadigmkeduadanketiga

agar permasalahan yang ditemukan segera

teratasi sehingga dapat meningkatkan hasil

belajar. Beberapa hal yang sekiranya dapat

menyelesaikanataumengatasipermasalahan

tersebut. Penulis berusaha menentukan

langkah-langkah sebagai berikut: a) me-

nentukanstrategipembelajaran;b)pemilihan

media dan sumber belajar yang relevan; c)

mempelajari faktor-faktor yangmenentukan

pemilihan strategi pembelajaran; d) pe-

netapan strategi “KKB” sebagai solusi

penanaman konsep membaca cepat. Dari

langkahtersebutpenulisakanmembahassatu

persatuuntukmempermudahparapembaca

dalammenelaahintimasalahinilebihlanjut.

MenentukanStrategiPembelajaran

Untukmendapatkanhasilbelajaryang

optimal seorang guru perlu menentukan

strategipembelajaran.StrategiPembelajaran

meliputipendekatanprosedur,mediamodel

danteknikyangdigunakandalammenyajikan

bahan pembelajaran atau isi kurikulum

(Sujana) 1988 dalam buku Pembaharuan

Pembelajaran, mengemukakan bahwa

Strategi Pembelajaran pada hakekatnya

adalah tindakan nyata dari seorang guru

dalam melaksanakan pembelajaran melalui

cara tertentu yang dinilai lebih efektif dan

lebih e�isien. Dengan kata lain strategi

berhubungandengansiasatatau taktikyang

digunakan guru dalam melaksanakan

kurikulumsecarasystemdansistematis.

Tinggi rendahnya aktivitas belajar

siswa banyak dipengaruhi oleh strategi

pendekatanmengajaryangdigunakandalam

menyampaikan bahan atau isi kurikulum.

RichardAnderson(Sujana1990)mengajukan

dua pendekatan yaitu: 1) Pendekatan yang

berorientasipadaguru.Dimanaaktivitasguru

dalam suatu proses pembelajaran lebih

dominan disbanding siswa; 2) Pendekatan

yangberorientasipadasiswa,dimanadalam

proses pembelajaran siswa lebih dominan

dibanding guru. Pendekatan ini membuat

siswa lebih aktif dalambelajar yangdikenal

jugadenganistilahProblemSolving.

Whole Language adalah salah satu

pendekatan pengajaran bahasa menyajikan

pengajaran bahasa secara utuh tidak dapat

dipisah-pisahkan (Edelsky,1991:Froese.

Page 47: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

46 47

dengan kelas VB. Tingkat pencapaian

pembelajaran biasanya dinyatakan dengan

nilai.Pembelajarandikatakanberhasilapabila

nilai rata-rata dari hasil ulangan telah

mencapaitargetlebihdari70%.Berdasarkan

hasil ulangan harian mata pelajaran bahasa

Indonesia (membaca cepat) siswa kelas VB

SDN001BatamKotahanya18dari33siswa

yang mencapai 70% keatas. Artinya 55%

s iswa yang baru mencapai t ingkat

keberhasilan. Sedangkan di kelas VA ada 29

dari 35 siswa yang telah mencapai tingkat

penguasaanmateri70%keatas.Atau91,63%

telah mencapai tingkat penguasaan materi

70% keatas. Menurut penulis, masalah ini

perlu dicari solusinya. Tujuan Penulisan

tujuan dari penelitian ini adalah untuk

peningkatanprestasibelajardanmotivasi

belajar Bahasa Indonesia setelah di-

terapkannya penggunaan model pen-

dekatanKKB.

Menurutpengalamanpenulis selama

lebihkurangsatusemester,pelajaranBahasa

Indonesia ( membaca cepat ) di kelas VB

kurang memuaskan. Bahkan memasuki

semester II ini, meskipun sudah diadakan

ulangan satu kali oleh penulis belum juga

berhasildenganbaik.Dari34siswakelasVB,

18siswayangmencapaitingkatkeberhasilan

75%keatas.Berdasarkanpengamatanpenulis

selama pembelajaran berlangsung siswa

kurang maksimal dan kurang merespon

terhadapmateri yangdiberikan.Adakalanya

suasanakelasributtidakmenentubahkanada

sebagiansiswayangasyiksendiri.

Berdasarkan beberapa temuan pe-

nulis mengidenti�ikasi masalah yang terjadi

dalampembelajaran:1)Siswakurangmem-

perhatikanpelajaranyangdiberikan;2)Siswa

menemuibeberapakesulitandalammembaca

cepat; 3) Metode pembelajaran yang

cenderung monoton; 4) Siswa kurang

maksimaldalammenerimamateripelajaran;

5) Alat peraga yang digunakan cenderung

kurangmendukung.

Berdasarkananalisis Identi�ikasima-

salah, penulis memfokuskan perbaikan

“MemotivasiMinatBacaSiswa“

PEMBAHASANMASALAH

Faktor membaca merupakan bagian

yang sangat penting dalam pengembangan

kompetensi dasar yang menjadi arah dan

landasan untuk mengembangkan bakat dan

kemampuan berbahasa sebagai pertim-

bangan bahwa individu itu lahir belum

mampu berbahasa, baik dalam kebiasaan,

cita-cita,sikap,pengetahuan,ketrampilandan

sebagainya.Kesemuanya itudapatdiperoleh

individu melalui interaksi dengan keluarga,

masyarakat sekitar, dan tentu saja dengan

bersekolah.Sekolahmempunyaitugaskhusus

untukmembagipengalamankepadasiswanya

denganbermacamcara.Salahsatunyaadalah

melalui pembelajaran Bahasa Indonesia

dengan “Memotivasi Minat Baca Siswa (

M2BS)”. Dilihat dari masalah yang dihadapi

siswa kelas VB apabila seseorang tidak

maksimal dalam mempelajari sesuatu hal,

tentu tidak dapat diharapkan dia akan

berhasildenganbaik.

Sebaiknya jika seseorang belajar

dengansungguh-sungguhdanmaksimalserta

mampumenerapkanbagaimanamemotivasi

minatbacakhususnyadalammembacacepat,

makadapatdiharapkanbahwahasilnyaakan

lebihbaik.Sebelummembahasstrategiuntuk

memotivasiminatbacakhususnyamembaca

cepat, terlebih dahulu penulis ingin me-

maparkan tentang adanya perubahan

paradigm pengajaran (Pembelajaran dan

ProsesBelajar(learning)DewiSalmaP.2000

dalam buku Pembaharuan Pembelajaran).

Adapunmaknadariparadigmaituantaralain:

1) Paradigma Pengajaran diartikan bahwa

pendidikanhanyaterjadidisekolah.Dimana

sudahadaguruyangmengajar.Gurusebagai

satu-satunya narasumber yang akan men-

transfer ilmu. Dalam proses pembelajaran,

guruberperansebagaipenyajimateri.Artinya

siswa hanya menyimak dan mengerjakan

tugas yang diberikan oleh guru. Guru tidak

melibatkan peran aktif siswa; 2) Paradigma

Pembelajaran diartikan lebih memberi

perhatiankepadasiswa.Dalampembelajaran

ini guru tidak hanya sebagai satu-satunya

narasumberdantidakhanyasebagaipengajar,

namun juga sebagai fasilitator yang

membantu siswa belajar. Komunikasi dan

pendekatan system mulai diterapkan.

Penerapan pendekatan system yaitu guru

sebagai sub system berperan dalam

merancang, mengolah dan menilai proses

pembelajaran. Penerapan Strategi “ M2BS “

denganpendekatan “KKB “ sebagai sumber

dan guru sebagai fasilitator; 3) Paradigma

proses belajar (learning) dimaksudkan agar

lebih menggali segala aspek belajar mulai

perencanaan konsep yang diawali dengan

bersifatkongkrit(nyata)sampaiyangbersifat

abstrak(tidaknyata).

Dari tiga paradigma diatas penulis

mengembangkanparadigmkeduadanketiga

agar permasalahan yang ditemukan segera

teratasi sehingga dapat meningkatkan hasil

belajar. Beberapa hal yang sekiranya dapat

menyelesaikanataumengatasipermasalahan

tersebut. Penulis berusaha menentukan

langkah-langkah sebagai berikut: a) me-

nentukanstrategipembelajaran;b)pemilihan

media dan sumber belajar yang relevan; c)

mempelajari faktor-faktor yangmenentukan

pemilihan strategi pembelajaran; d) pe-

netapan strategi “KKB” sebagai solusi

penanaman konsep membaca cepat. Dari

langkahtersebutpenulisakanmembahassatu

persatuuntukmempermudahparapembaca

dalammenelaahintimasalahinilebihlanjut.

MenentukanStrategiPembelajaran

Untukmendapatkanhasilbelajaryang

optimal seorang guru perlu menentukan

strategipembelajaran.StrategiPembelajaran

meliputipendekatanprosedur,mediamodel

danteknikyangdigunakandalammenyajikan

bahan pembelajaran atau isi kurikulum

(Sujana) 1988 dalam buku Pembaharuan

Pembelajaran, mengemukakan bahwa

Strategi Pembelajaran pada hakekatnya

adalah tindakan nyata dari seorang guru

dalam melaksanakan pembelajaran melalui

cara tertentu yang dinilai lebih efektif dan

lebih e�isien. Dengan kata lain strategi

berhubungandengansiasatatau taktikyang

digunakan guru dalam melaksanakan

kurikulumsecarasystemdansistematis.

Tinggi rendahnya aktivitas belajar

siswa banyak dipengaruhi oleh strategi

pendekatanmengajaryangdigunakandalam

menyampaikan bahan atau isi kurikulum.

RichardAnderson(Sujana1990)mengajukan

dua pendekatan yaitu: 1) Pendekatan yang

berorientasipadaguru.Dimanaaktivitasguru

dalam suatu proses pembelajaran lebih

dominan disbanding siswa; 2) Pendekatan

yangberorientasipadasiswa,dimanadalam

proses pembelajaran siswa lebih dominan

dibanding guru. Pendekatan ini membuat

siswa lebih aktif dalambelajar yangdikenal

jugadenganistilahProblemSolving.

Whole Language adalah salah satu

pendekatan pengajaran bahasa menyajikan

pengajaran bahasa secara utuh tidak dapat

dipisah-pisahkan (Edelsky,1991:Froese.

Page 48: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

48 49

1990;Goodman.1986;Weaver.1992).Paraahli

WholeLanguageberkeyakinanbahwabahasa

merupakansatukesatuan(whole)yangtidak

dapatdipisah-pisahkan(Rigg.1991).

Pendekatan Whole Language didasari

olehpahamconstructivismyangmenyatakan

bahwa siswa atau anak membentuk sendiri

pengetahuannya melalui peran aktifnya

dalambelajarsecarautuh(whole)danterpadu

(integrated)(Roberts.1996).

Salah satu aspek pembelajaran bahasa

Indonesia SD adalah membaca khususnya

membacacepat.Membacainibertujuanagar

siswa dapat menangkap isi bacaan dalam

waktu yang cepat, dalam hal ini guru harus

menentukan waktu yang sesuai dengan

tingkat kesukaan bahan bacaan. Untuk itu

siswa perlu dilatih gerakan mata, arah

pandanganlurus,dariataskebawah,hindari

membaca kata demi kata, dan menunjuk

bacaan dengan satu jari. Membaca ini

diberikan di kelas tinggi, mulai kelas 4

(Tarigan1984;Dawsonetal1981).

Selain hal tersebut di atas seorang

guruhendaknyaberusahamemotivasiminat

bacasiswa.MenurutHurlock(1989)adacara

minat mempengaruhi perkembangan siswa:

1) Minat dapat mempengaruhi bentuk dan

intensitas aspirasi . J ika anak mulai

memikirkantentangmasadepan,makaanak

akan mencoba menentukan tujuan dan

sasaranyangakandicapaisertadilakukanjika

ia bertambah besar. Misalnya anak laki-laki

yangberminatpada�ilmperangdanpesawat

akanbercita-citamenjadipenerbang;2)Minat

dapatsebagaimotivasi

Anak yang berminat pada suatu

kegiatan akan berusaha untuk melakukan

kegiatan dengan lebih baik dari pada anak

yang tidakmempunyaiminat pada kegiatan

tersebut.

1. Minatberpengaruhpadaprestasi

Anak yang berminat pada suatu

pelajaran akan belajar dan berusaha

mendapatnilaiyang lebihbaik.Minatdapat

menimbulkanrasasenangpadakegiatanyang

dipilih;3)Minatyangberkembangpadamasa

kanak-kanakdapatmenjadiminatselamanya.

Anakyangselalumelakukankegiatan

yang berkaitan dengan minatnya lama

kelamaan akan timbul kebiasaan dan akan

terusbertahanmenjadiminatselamanya.

Menurut Krapp, Hadi dan Renninger

(dalam Pintrich dan Schunk.1996) bahwa

minat merupakan aspek penting yang

mempengaruhi perhatian, belajar, berpikir,

dan berprestasi. Minat berperan penting

dalamkehidupanseseorangdanberpengaruh

besarpadatingkahlakudansikapseseorang.

Sedangkanmenurut teoriTabularasa bahwa

anak lahir laksanakertasputihyangkosong

yang belum diisi berbagai hal dengan

demikian minat tidak ada dari lahir karena

minat berkembang melalui pengalaman

belajar. Berdasarkan teori ini lingkungan

sekolahmerupakantempatyangtepatuntuk

memunculkan dan mengembangkan minat

seseorang dan guru memegang peranan

pentinguntukmemunculkanminattersebut.

Guru yang berkualitas adalah guru

yang memiliki kemampuan sesuai dengan

profesi yang disandangnya. Guru harus

mampu mendidik, mengajar dan melatih.

Mendidik berarti meneruskan dan me-

ngembangkan nilai-nilai hidup, Mengajar

berarti meneruskan dan mengembangkan

ilmu pengetahuan dan teknologi sedangkan

Melatihberartimembinaketrampilan,minat

danbakatsiswa.MenurutPembelajarandan

Pengajaran Kontekstual (CTL, Contextual

Teaching and Learning) tidak akan ada

perkembangan mental tanpa adanya minat.

Minat adalah dasar dari perhatian dan

pemahaman(Whitehead.1929b/1967.h.31).

Penulisinginmengadakanperbaikan

pembelajaran dengan menggunakan system

ContextualTeachingandLearning(CTL)yaitu

sebuahsystembelajaryangdidasarkanpada

�iloso�ibahwaseorangpembelajarakanmau

danmampumenyerapmateri pelajaran jika

mereka dapat menangkap makna dari

pelajarantersebut.

Melalui kebermaknaan belajar,

menurut Ausubel, bermakna atau tidaknya

suatubahanataumateripelajarantergantung

bahan dan anak. Bila anakmemulai belajar

pada saat yang tepat dan bahan ajar benar-

benar dapat dipahami akan terjadi proses

belajar yang bermakna. Kunci menuju

kebermaknaan be la jar menyangkut

hubungan yang erat antara bahan baru

denganidepengetahuanyangtelahadadalam

pikiran siswa. Menurut penulis, guru harus

bisa menciptakan kiat-kiat di dalam

pembelajaran yang dapat menumbuhkan

minat belajar pada siswa. Untuk itu guru

harusdapatmenentukanstrategiyangtepat.

Dalam penyampaian materi mata

pelajaran Bahasa Indonesia pada aspek

membaca khususnya membaca cepat

menggunakanpendekatanyangberorientasi

padasiswaagarapayangsudahdirencanakan

dengan baik. Di sini ada beberapa Strategi

pembelajaran yang diterapkan oleh penulis

untukmenumbuhkanminatbelajarpadaanak

adalah sebagaiberikut:1)Memotivasi Siswa

dalam Belajar.Motivasi merupakan kondisi

internal pada diri anak untuk melakukan

kegiatan belajar.Motivasi akanmenentukan

arahdanintensitas(kekuatan)perilakudalam

kegiatan belajar denganmotivasi yang kuat

anak akan lebih terarah dan lebih kuat

tindakan belajarnya. Oleh karena itu

membangkitkan motivasi anak adalah

langkahawalyangharusdilakukanolehguru

agar anak memiliki kesiapan dalam

melakukankegiatanbelajar.Misalnyadengan

caramemutarkanvideohasilrekamanacara

lombaporseniyangpernahdiikutiolehrekan-

rekan atau kakak kelasnya. Atau dapat

menceritakan hal-hal menarik yang

berhubungan dengan membaca; 2) Men-

ciptakan Lingkungan Belajar yang Kondusif.

Pendidikan di Sekolah dan diluar sekolah

tidak boleh dilepaskan dari lingkungannya.

Oleh karena itu keberhasilan suatu pen-

didikanakanbanyakditentukanolehkeadaan

lingkungannya. Lingkungan yang kondusif

adalahlingkunganyangdapatmenunjangbagi

proses belajar mengajar secara efektif; 3)

Mempersiapkan Sarana Belajar yang Me-

nunjang.ProsesBelajardanPengajaranakan

berlangsung secara efektif apabiladitunjang

dengan sarana yang baik. Sarana tersebut

adalahalatbantumengajar.Misalnyadengan

menggunakan VCD , LCD , CD a t a u

Laboratorium, Perpustakaandan lainnya; 4)

MenciptakanPembelajaranyangBermakna

Seorangsiswaakanmaudanmampu

menyerapmateripelajaranjikamerekadapat

menangkapmaknapelajarantersebut.Tugas

guru adalah mengolah bahan pengajaran

menjadisajianyangdapatdicernaolehsiswa

secaratepatdanbermakna.Untukitubahan

yang diajarkan hendaknya harus sesuai

dengan kondisi siswa dan lingkungannya

sehinggamemberikanmaknadanfaedahbagi

siswa. Dengan bahan yang dirasakan sesuai

dan bermanfaat siswa akan melakukan

aktivitas pembelajaran dengan lebih

bergairah; 5) Menggerakkan Pagi Membaca

(themorningreading)

Lima belas menit sebelum lonceng

kedua berbunyi tanda dimulainya proses

Page 49: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

48 49

1990;Goodman.1986;Weaver.1992).Paraahli

WholeLanguageberkeyakinanbahwabahasa

merupakansatukesatuan(whole)yangtidak

dapatdipisah-pisahkan(Rigg.1991).

Pendekatan Whole Language didasari

olehpahamconstructivismyangmenyatakan

bahwa siswa atau anak membentuk sendiri

pengetahuannya melalui peran aktifnya

dalambelajarsecarautuh(whole)danterpadu

(integrated)(Roberts.1996).

Salah satu aspek pembelajaran bahasa

Indonesia SD adalah membaca khususnya

membacacepat.Membacainibertujuanagar

siswa dapat menangkap isi bacaan dalam

waktu yang cepat, dalam hal ini guru harus

menentukan waktu yang sesuai dengan

tingkat kesukaan bahan bacaan. Untuk itu

siswa perlu dilatih gerakan mata, arah

pandanganlurus,dariataskebawah,hindari

membaca kata demi kata, dan menunjuk

bacaan dengan satu jari. Membaca ini

diberikan di kelas tinggi, mulai kelas 4

(Tarigan1984;Dawsonetal1981).

Selain hal tersebut di atas seorang

guruhendaknyaberusahamemotivasiminat

bacasiswa.MenurutHurlock(1989)adacara

minat mempengaruhi perkembangan siswa:

1) Minat dapat mempengaruhi bentuk dan

intensitas aspirasi . J ika anak mulai

memikirkantentangmasadepan,makaanak

akan mencoba menentukan tujuan dan

sasaranyangakandicapaisertadilakukanjika

ia bertambah besar. Misalnya anak laki-laki

yangberminatpada�ilmperangdanpesawat

akanbercita-citamenjadipenerbang;2)Minat

dapatsebagaimotivasi

Anak yang berminat pada suatu

kegiatan akan berusaha untuk melakukan

kegiatan dengan lebih baik dari pada anak

yang tidakmempunyaiminat pada kegiatan

tersebut.

1. Minatberpengaruhpadaprestasi

Anak yang berminat pada suatu

pelajaran akan belajar dan berusaha

mendapatnilaiyang lebihbaik.Minatdapat

menimbulkanrasasenangpadakegiatanyang

dipilih;3)Minatyangberkembangpadamasa

kanak-kanakdapatmenjadiminatselamanya.

Anakyangselalumelakukankegiatan

yang berkaitan dengan minatnya lama

kelamaan akan timbul kebiasaan dan akan

terusbertahanmenjadiminatselamanya.

Menurut Krapp, Hadi dan Renninger

(dalam Pintrich dan Schunk.1996) bahwa

minat merupakan aspek penting yang

mempengaruhi perhatian, belajar, berpikir,

dan berprestasi. Minat berperan penting

dalamkehidupanseseorangdanberpengaruh

besarpadatingkahlakudansikapseseorang.

Sedangkanmenurut teoriTabularasa bahwa

anak lahir laksanakertasputihyangkosong

yang belum diisi berbagai hal dengan

demikian minat tidak ada dari lahir karena

minat berkembang melalui pengalaman

belajar. Berdasarkan teori ini lingkungan

sekolahmerupakantempatyangtepatuntuk

memunculkan dan mengembangkan minat

seseorang dan guru memegang peranan

pentinguntukmemunculkanminattersebut.

Guru yang berkualitas adalah guru

yang memiliki kemampuan sesuai dengan

profesi yang disandangnya. Guru harus

mampu mendidik, mengajar dan melatih.

Mendidik berarti meneruskan dan me-

ngembangkan nilai-nilai hidup, Mengajar

berarti meneruskan dan mengembangkan

ilmu pengetahuan dan teknologi sedangkan

Melatihberartimembinaketrampilan,minat

danbakatsiswa.MenurutPembelajarandan

Pengajaran Kontekstual (CTL, Contextual

Teaching and Learning) tidak akan ada

perkembangan mental tanpa adanya minat.

Minat adalah dasar dari perhatian dan

pemahaman(Whitehead.1929b/1967.h.31).

Penulisinginmengadakanperbaikan

pembelajaran dengan menggunakan system

ContextualTeachingandLearning(CTL)yaitu

sebuahsystembelajaryangdidasarkanpada

�iloso�ibahwaseorangpembelajarakanmau

danmampumenyerapmateri pelajaran jika

mereka dapat menangkap makna dari

pelajarantersebut.

Melalui kebermaknaan belajar,

menurut Ausubel, bermakna atau tidaknya

suatubahanataumateripelajarantergantung

bahan dan anak. Bila anakmemulai belajar

pada saat yang tepat dan bahan ajar benar-

benar dapat dipahami akan terjadi proses

belajar yang bermakna. Kunci menuju

kebermaknaan be la jar menyangkut

hubungan yang erat antara bahan baru

denganidepengetahuanyangtelahadadalam

pikiran siswa. Menurut penulis, guru harus

bisa menciptakan kiat-kiat di dalam

pembelajaran yang dapat menumbuhkan

minat belajar pada siswa. Untuk itu guru

harusdapatmenentukanstrategiyangtepat.

Dalam penyampaian materi mata

pelajaran Bahasa Indonesia pada aspek

membaca khususnya membaca cepat

menggunakanpendekatanyangberorientasi

padasiswaagarapayangsudahdirencanakan

dengan baik. Di sini ada beberapa Strategi

pembelajaran yang diterapkan oleh penulis

untukmenumbuhkanminatbelajarpadaanak

adalah sebagaiberikut:1)Memotivasi Siswa

dalam Belajar.Motivasi merupakan kondisi

internal pada diri anak untuk melakukan

kegiatan belajar.Motivasi akanmenentukan

arahdanintensitas(kekuatan)perilakudalam

kegiatan belajar denganmotivasi yang kuat

anak akan lebih terarah dan lebih kuat

tindakan belajarnya. Oleh karena itu

membangkitkan motivasi anak adalah

langkahawalyangharusdilakukanolehguru

agar anak memiliki kesiapan dalam

melakukankegiatanbelajar.Misalnyadengan

caramemutarkanvideohasilrekamanacara

lombaporseniyangpernahdiikutiolehrekan-

rekan atau kakak kelasnya. Atau dapat

menceritakan hal-hal menarik yang

berhubungan dengan membaca; 2) Men-

ciptakan Lingkungan Belajar yang Kondusif.

Pendidikan di Sekolah dan diluar sekolah

tidak boleh dilepaskan dari lingkungannya.

Oleh karena itu keberhasilan suatu pen-

didikanakanbanyakditentukanolehkeadaan

lingkungannya. Lingkungan yang kondusif

adalahlingkunganyangdapatmenunjangbagi

proses belajar mengajar secara efektif; 3)

Mempersiapkan Sarana Belajar yang Me-

nunjang.ProsesBelajardanPengajaranakan

berlangsung secara efektif apabiladitunjang

dengan sarana yang baik. Sarana tersebut

adalahalatbantumengajar.Misalnyadengan

menggunakan VCD , LCD , CD a t a u

Laboratorium, Perpustakaandan lainnya; 4)

MenciptakanPembelajaranyangBermakna

Seorangsiswaakanmaudanmampu

menyerapmateripelajaranjikamerekadapat

menangkapmaknapelajarantersebut.Tugas

guru adalah mengolah bahan pengajaran

menjadisajianyangdapatdicernaolehsiswa

secaratepatdanbermakna.Untukitubahan

yang diajarkan hendaknya harus sesuai

dengan kondisi siswa dan lingkungannya

sehinggamemberikanmaknadanfaedahbagi

siswa. Dengan bahan yang dirasakan sesuai

dan bermanfaat siswa akan melakukan

aktivitas pembelajaran dengan lebih

bergairah; 5) Menggerakkan Pagi Membaca

(themorningreading)

Lima belas menit sebelum lonceng

kedua berbunyi tanda dimulainya proses

Page 50: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

50 51

pembelajaran.Siswadiharuskanpegangbuku

yang diminati atau disukai tentunya sesuai

dengan buku-buku penunjang pelajaran.

Kemudian membacanya. Hal ini dilakukan

setiap pagi dengan tujuan agar siswa lebih

termotivasi dan lebih siap dalammengikuti

prosespembelajaransertamampumenerima

dan menyerap berbagai informasi yang

diberikan oleh guru; 6) Mempersiapkan

GenerasiBerprestasi.Mengikutsertakansiswa

yang berpotensi pada berbagai ajang

kompetisi untuk unjuk kebolehan sekaligus

mengukursejauhmanakemampuanmereka

berbahasa. Hal ini juga dapat memotivasi

siswa-siswa yang lain untuk lebih giat

belajar,khususnyabelajarmembacacepat;7)

Mempersiapkan Generasi yang Berkualitas.

Memotivasi keinginan siswa menguasai

berbagaiilmuakibatcepatnyaperkembangan

dunia informasi dan teknologi yang serba

canggih. Hal ini menuntut bakat dan

kemampuansiswadalamberbahasa.

Penulis sebagai guru mata pelajaran

Bahasa Indonesiaakanmenerapkan strategi

pembelajaran tersebut untuk mengatasi

masalahyangdihadapisiswakelasVBdiSDN

001 Batam Kota. Mengapa di sekolah yang

sama, tingkatkelasyang sama,denganguru

yang sama harus terjadi kesenjangan nilai

antarakelasVAdengankelasVB.

Sebagai bahan perbandingan nilai

antara kelas VA dengan kelas VB adalah

sebagaiberikut:

Tabel 1. Perbandingan nilai ulangan harian

Bahasa Indonesia(membacacepat)

antarakelasVAdengankelasVB.

KelasVA KelasVB70% 70%

70%

70%

3siswa 29siswa 16siswa 17siswa

(9,37%)(91,63%)

(47,05%)

(52,95%)

PemilihanMediadanSumberBelajar

Dalam merancang kegiatan pem-

belajaran kita perlu memperhatikan

komponen pembelajaran. Untuk lebih

jelasnyapenulismemaparkantentangkonsep

mediadanfungsimediapembelajaran.

Secaraumummediadiartikansebagai

medium atau perantara. Dalam kaitannya

dengan proses komunikasi pembelajaran,

menurut penulis media diartikan sebagai

wahana dalam menyampaikan pesan atau

materi pembelajaran. Namun beberapa ahli

dan asosiasi mengemukakan pengertian

media pembelajaran, pertama mengartikan

bahwa media pembelajaran sebagai sarana

komunikasibaikdalambentukcetakmaupun

pandang dengar, (Nea,1969). Kedua

mende�inisikan bahwa media pembelajaran

sebagaiteknologipembawapesanyangdapat

dimanfaatkan untuk kepentingan pem-

belajaran,(WilburSchrahman,1977).

Penulis dapat menyimpulkan bahwa

antara media dengan alat sangat erat

hubunganatausalingberkaitan.Mediaadalah

carauntukmenyampaikanpesansedangalat

untuk menyampaikan pesan diperlukan

media. Denganmedia dan alat yang relevan

insyaAllahmateriyangdisampaikanmudah

dipahami dan sukses dalam dunia kegiatan

pembelajaran.

Dalam kehidupan sehari-hari begitu

banyak media yang dapat digunakan untuk

kepentinganpembelajaran.Penulismembuat

klasi�ikasimedia terdiriduakelompokyaitu

mediasederhanasepertipapantulis,gambar,

poster, dan lain-lain, media canggih,

contohnya radio, �ilm, OHP, LSD dan

sebagainya.FungsiMedia:a)Dapatmembantu

penanaman konsep yang lebih mudah pada

siswa meningkatkan motivasi siswa dalam

belajar;b)Menciptakansuasanabelajar jadi

lebihhidupataukondusif;c)Penyajianmateri

lebihpraktisdanmengasyikkan.

Kendala-kendala yang Dihadapi dalam

MelaksanakanStrategiyangDipilih

Disinipenulismenggalitentangkendala-

kendala apa saja yang dihadapi dalam

melaksanakan strategi yang dipilih. Sering

kitatemuidalamprosespembelajaransiswa

sulitmengkomunikasikanataumenangkapisi

wacanayangdisajikan.Kesulitanbelajaryang

dihadapi oleh siswa disebabkan oleh

beberapafaktorantaralainfaktorinterndan

faktoreksternal.

FaktorInternadalahfaktoryangterdapat

dalam dirinya antara lain : 1) Kurangnya

kemampuan dasar (intelegensi) merupakan

wadah bagi kemungkinan tercapainya hasil

belajar, 2) Kurangnya bakat khusus yang

mendasari kegiatan belajar tertentu, 3)

Kurangmotivasiataudoronganuntukbelajar.

Tanpa motif yang memadai, siswa akan

banyak mengalami kesulitan belajar, karena

motif ini merupakan faktor pendorong, 4)

Situasi pribadi terutama emosional yang

dialami siswa, 4) Factor-faktor jasmaniah,

sepert i cacat tubuh , gangguan ke-

sehatan,gangguanpenglihatan,pendengaran,

kelainanjasmani,dansebagainya,5)Faktor-

faktorbawaan(heriditer)sepertibutawarna,

kidal,cacattubuhdansebagainya.

Faktor Eksternal yaitu faktor yang

terletakdiluardirinyaantaralain:1)Faktor

lingkungan sekolah yang kurang memadai

seperticaramengajar,sikapguru,kurikulum

ataumateri yang dipelajari, situasi sosial di

sekolah, dan sebagainya, 2) Situasi dalam

keluarga yang kurang mendukung seperti

kekacauan rumah tangga (broken home),

kurangperhatianorangtua,dansebagainya,

3) Lingkungan sosial yangkurangmemadai,

seperti pengaruh negative dari pergaulan,

situasi masyarakat yang kacau, gangguan

kebudayaanseperti�ilm,bacaanyangkurang

mendidik,dansebagainya.

Faktor-faktor Pendukung: a) Membuat

tu juan pembe la j a ran khusus yang

diharapkanakan lebihmudahdicapaisiswa.

Dengan memperhatikan TPK seorang guru

memil ih strategi yang cocok untuk

disampaikan, b) Karakteristik materi

pembelajaran. Setiap materi pembelajaran

memilikiciritersendiri.,misalnyamateriIPA

seringberorientasipadakegiatanmengamati

keadaan luar, kemudian menyimpulkan.

Sedangkan materi bahasa Indonesia

berorientasi pada aspek mendengar,

berbicara, membaca, dan menulis yang

memberi penekanan pada kemampuan dan

ketrampilan untuk berbahasa lisan dalam

kehidupan sehari-hari, c) Fasilitas yang

tersedia. Pemilihan media dan strategi

pembelajaran harus disesuaikan dengan

fasilitas lingkungan sekolah. Misalnya kita

mengadakanwawancaradengannarasumber

terlebih dahulu kita cermati ada tidaknya

bahandanalatuntukwawancara.

Dari faktor-faktor tersebut penulis

berusaha menyesuaikan teknik dan media

pembelajarandengankebutuhanmateriyang

penulistemukandalamkompetensimembaca

cepat. Mengapa penulis disini menentukan

teknikdanmediapembelajaranyangmungkin

membantusiswaagarlebihmudahmengerti

atau menemukan sendiri aspek yang

diberikan,alasannyaadalahsebagaiberikut:

1)Penulismenyadaribahwakecepatansiswa

dalamberpikirataumenerimamaterisangat

bervariasi, 2) Hampir sebagian besar guru,

konsep yang disampaikan berdasarkan

kemampuan pikirannya. Padahal pola

berpikir siswa tidak sama dengan pola

Page 51: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

50 51

pembelajaran.Siswadiharuskanpegangbuku

yang diminati atau disukai tentunya sesuai

dengan buku-buku penunjang pelajaran.

Kemudian membacanya. Hal ini dilakukan

setiap pagi dengan tujuan agar siswa lebih

termotivasi dan lebih siap dalammengikuti

prosespembelajaransertamampumenerima

dan menyerap berbagai informasi yang

diberikan oleh guru; 6) Mempersiapkan

GenerasiBerprestasi.Mengikutsertakansiswa

yang berpotensi pada berbagai ajang

kompetisi untuk unjuk kebolehan sekaligus

mengukursejauhmanakemampuanmereka

berbahasa. Hal ini juga dapat memotivasi

siswa-siswa yang lain untuk lebih giat

belajar,khususnyabelajarmembacacepat;7)

Mempersiapkan Generasi yang Berkualitas.

Memotivasi keinginan siswa menguasai

berbagaiilmuakibatcepatnyaperkembangan

dunia informasi dan teknologi yang serba

canggih. Hal ini menuntut bakat dan

kemampuansiswadalamberbahasa.

Penulis sebagai guru mata pelajaran

Bahasa Indonesiaakanmenerapkan strategi

pembelajaran tersebut untuk mengatasi

masalahyangdihadapisiswakelasVBdiSDN

001 Batam Kota. Mengapa di sekolah yang

sama, tingkatkelasyang sama,denganguru

yang sama harus terjadi kesenjangan nilai

antarakelasVAdengankelasVB.

Sebagai bahan perbandingan nilai

antara kelas VA dengan kelas VB adalah

sebagaiberikut:

Tabel 1. Perbandingan nilai ulangan harian

Bahasa Indonesia(membacacepat)

antarakelasVAdengankelasVB.

KelasVA KelasVB70% 70%

70%

70%

3siswa 29siswa 16siswa 17siswa

(9,37%)(91,63%)

(47,05%)

(52,95%)

PemilihanMediadanSumberBelajar

Dalam merancang kegiatan pem-

belajaran kita perlu memperhatikan

komponen pembelajaran. Untuk lebih

jelasnyapenulismemaparkantentangkonsep

mediadanfungsimediapembelajaran.

Secaraumummediadiartikansebagai

medium atau perantara. Dalam kaitannya

dengan proses komunikasi pembelajaran,

menurut penulis media diartikan sebagai

wahana dalam menyampaikan pesan atau

materi pembelajaran. Namun beberapa ahli

dan asosiasi mengemukakan pengertian

media pembelajaran, pertama mengartikan

bahwa media pembelajaran sebagai sarana

komunikasibaikdalambentukcetakmaupun

pandang dengar, (Nea,1969). Kedua

mende�inisikan bahwa media pembelajaran

sebagaiteknologipembawapesanyangdapat

dimanfaatkan untuk kepentingan pem-

belajaran,(WilburSchrahman,1977).

Penulis dapat menyimpulkan bahwa

antara media dengan alat sangat erat

hubunganatausalingberkaitan.Mediaadalah

carauntukmenyampaikanpesansedangalat

untuk menyampaikan pesan diperlukan

media. Denganmedia dan alat yang relevan

insyaAllahmateriyangdisampaikanmudah

dipahami dan sukses dalam dunia kegiatan

pembelajaran.

Dalam kehidupan sehari-hari begitu

banyak media yang dapat digunakan untuk

kepentinganpembelajaran.Penulismembuat

klasi�ikasimedia terdiriduakelompokyaitu

mediasederhanasepertipapantulis,gambar,

poster, dan lain-lain, media canggih,

contohnya radio, �ilm, OHP, LSD dan

sebagainya.FungsiMedia:a)Dapatmembantu

penanaman konsep yang lebih mudah pada

siswa meningkatkan motivasi siswa dalam

belajar;b)Menciptakansuasanabelajar jadi

lebihhidupataukondusif;c)Penyajianmateri

lebihpraktisdanmengasyikkan.

Kendala-kendala yang Dihadapi dalam

MelaksanakanStrategiyangDipilih

Disinipenulismenggalitentangkendala-

kendala apa saja yang dihadapi dalam

melaksanakan strategi yang dipilih. Sering

kitatemuidalamprosespembelajaransiswa

sulitmengkomunikasikanataumenangkapisi

wacanayangdisajikan.Kesulitanbelajaryang

dihadapi oleh siswa disebabkan oleh

beberapafaktorantaralainfaktorinterndan

faktoreksternal.

FaktorInternadalahfaktoryangterdapat

dalam dirinya antara lain : 1) Kurangnya

kemampuan dasar (intelegensi) merupakan

wadah bagi kemungkinan tercapainya hasil

belajar, 2) Kurangnya bakat khusus yang

mendasari kegiatan belajar tertentu, 3)

Kurangmotivasiataudoronganuntukbelajar.

Tanpa motif yang memadai, siswa akan

banyak mengalami kesulitan belajar, karena

motif ini merupakan faktor pendorong, 4)

Situasi pribadi terutama emosional yang

dialami siswa, 4) Factor-faktor jasmaniah,

sepert i cacat tubuh , gangguan ke-

sehatan,gangguanpenglihatan,pendengaran,

kelainanjasmani,dansebagainya,5)Faktor-

faktorbawaan(heriditer)sepertibutawarna,

kidal,cacattubuhdansebagainya.

Faktor Eksternal yaitu faktor yang

terletakdiluardirinyaantaralain:1)Faktor

lingkungan sekolah yang kurang memadai

seperticaramengajar,sikapguru,kurikulum

ataumateri yang dipelajari, situasi sosial di

sekolah, dan sebagainya, 2) Situasi dalam

keluarga yang kurang mendukung seperti

kekacauan rumah tangga (broken home),

kurangperhatianorangtua,dansebagainya,

3) Lingkungan sosial yangkurangmemadai,

seperti pengaruh negative dari pergaulan,

situasi masyarakat yang kacau, gangguan

kebudayaanseperti�ilm,bacaanyangkurang

mendidik,dansebagainya.

Faktor-faktor Pendukung: a) Membuat

tu juan pembe la j a ran khusus yang

diharapkanakan lebihmudahdicapaisiswa.

Dengan memperhatikan TPK seorang guru

memil ih strategi yang cocok untuk

disampaikan, b) Karakteristik materi

pembelajaran. Setiap materi pembelajaran

memilikiciritersendiri.,misalnyamateriIPA

seringberorientasipadakegiatanmengamati

keadaan luar, kemudian menyimpulkan.

Sedangkan materi bahasa Indonesia

berorientasi pada aspek mendengar,

berbicara, membaca, dan menulis yang

memberi penekanan pada kemampuan dan

ketrampilan untuk berbahasa lisan dalam

kehidupan sehari-hari, c) Fasilitas yang

tersedia. Pemilihan media dan strategi

pembelajaran harus disesuaikan dengan

fasilitas lingkungan sekolah. Misalnya kita

mengadakanwawancaradengannarasumber

terlebih dahulu kita cermati ada tidaknya

bahandanalatuntukwawancara.

Dari faktor-faktor tersebut penulis

berusaha menyesuaikan teknik dan media

pembelajarandengankebutuhanmateriyang

penulistemukandalamkompetensimembaca

cepat. Mengapa penulis disini menentukan

teknikdanmediapembelajaranyangmungkin

membantusiswaagarlebihmudahmengerti

atau menemukan sendiri aspek yang

diberikan,alasannyaadalahsebagaiberikut:

1)Penulismenyadaribahwakecepatansiswa

dalamberpikirataumenerimamaterisangat

bervariasi, 2) Hampir sebagian besar guru,

konsep yang disampaikan berdasarkan

kemampuan pikirannya. Padahal pola

berpikir siswa tidak sama dengan pola

Page 52: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

52 53

berpikirgurutersebut,3)Penulismemahami

bahwapolaberpikir siswaSDbergerakdari

hal-halyangbersifatabstrakatautidaknyata.

Penerapan Strategi “KKB” sebagai

Solusi Penanaman Aspek Membaca Cepat.

Membacacepattermasukkategorimembaca

lanjutdandiajarkandikelastinggiyaitumulai

kelas 4. Masalah yang ditemukan dalam

membaca dibagi menjadi tiga kelompok

berdasarkanKecepatandanKecermatanBaca

( KKB ) : a) Membaca cepat tetapi kurang

cermat,b)Membacalambattetapicermat,c)

Membacalambatdankurangcermat.

Ada beberapa hal yang dapat

mengakibatkankurangcermatnyamembaca:

1) Pengamatan Siswa. Siswa yang ceroboh

dalammengamatihuruf,sukukata,kata,titik,

koma, dan sebagainya, akan kurang

penangkapannya, bahkan mungkin salah

tafsir, terkadangmerekamelewatikatayang

penting.Misalnya:SiDididibacaDidi.Bajunya

tidakputihdibacabajunyaputih;2)Perhatian

siswawaktusedangmembaca.Perhatiananak

tidak mustahil melayang kemana-mana.

Dalam berhitung, pembelokan perhatian itu

tampak jelas sebab menghasilkan jawaban

yangsalah.Tetapidalampelajaranmembaca

seringtidaknampakkeluar.Apabilaperhatian

tidak tertuju kepada bacaan, tentu tidak

menangkap apa yang dibacanya; 3) Siswa

kurang menangkap rangkaian kata. Yang

mereka baca hanyalah kata-kata satu demi

satu secara terpisah. Hal ini pun me-

ngakibatkantakdapatmenangkapisibacaan;

4) Penyebab lain adalah tidakmengerti apa

artikata.Siswayangsedikitperbendaharaan

katanya tak akan dapatmenangkapmaksud

penulis;5)Kebiasaanmembacadengansuara

keras. Akibatnya kurang memusatkan per-

hatian pada isi bacaan; 6) Kekurangcepatan

membaca, hal ini disebabkan oleh beberapa

hal.Salahsatudiantaranyaialahterlaluhati-

hati menganalisa tulisan. Siswa yang tidak

yakin bahwa suatu kata berbunyi orang,

menganalisa kata tersebut menjadi huruf-

huruf yang berdiri sendiri sebelum mem-

bacanya. Jadi : orang. demikian pula halnya

siswayangtidakyakindengankata-katalain;

7) Hal lain yang mengakibatkan lambatnya

membaca ialah reaksi mental. Siswa yang

lambat reaksi mentalnya akan lambat pula

membacanya; 8) Penyebab lain ialah

kebiasaankomatkamitwaktumembaca,atau

membayangkanbunyinnyadalamhati.

Apabila hal-hal yang mengakibatkan

kurangcermatmembacahadirbersama-sama

dalam diri seorang siswa. Maka siswa itu

menjadilambatmembacadankurangcermat.

Olehkarenaitupenulisinginmengangkatatau

memaparkanbagaimana“MemotivasiMinat

Baca Siswa ( M2BS ) dengan pendekatan

strategi“KKB”sebagailangkahmelatihsiswa.

PenerapanStrategi“KKB”terdiridari

dua langkah latihan, yaitu : a) Latihan

KecepatanBaca,b)LatihanKecermatanBaca.

Latihan Kecepatan Baca. Kartu Kalimat,

tulislah kalimat-kalimat pada kartu-kartu

atau kertas panjang. Setiap kartu hanya

memuat satu kalimat. Kalimat-kalimat

tersebutdapatdibagitigakelompok:kalimat

berita, kalimat Tanya, dan kalimat perintah.

Perlihatkankartu-kartutersebutdalamwaktu

yang sangat singkat.Bila yangdiperlihatkan

itu kalimat berita, minta siswa membaca

kalimat tersebut dengan hanya melihatnya

sebentar. Jika kalimatnya kalimat Tanya,

mintalahsiswamenjawabnya.Jikakalimatnya

kalimat perintahmintalah siswamelakukan

perintahyangadadidalamnya;2)Mengisikan

Kata. ambillah beberapa kalimat dari buku

bacaannya sehari-hari. Tulislah tiap-tiap

kalimat pada sehelai karton panjang.

Kosongkan salah satu kata pada setiap

kalimat.Tunjukkankalimat-kalimat tersebut

satudemisatu,masing-masingdalamwaktu

yangsingkat.Tugassiswaialahmenyebutkan

kata yang seharusnya ada pada tempat

kosong; 3) Kutipan Mencari Ungkapan.

kutiplahpadapapantulisbeberapaungkapan

yang diambil dari buku yang belum pernah

dibacasiswa.Mintalahsiswamembacabuku

yang dikutip tersebut.ia harus mencari

ungkapan tersebut pada buku-buku itu; 4)

Membaca Cepat, mintalah siswa membaca

bahan yang sangat sederhana dalam waktu

yang telah ditentukan. Kecepatan baca akan

diketahui dari jawaban atas pertanyaan-

pertanyaanmengenaibahantersebut.

Latihan Kecermatan Baca, Beberapa

kegiatan dapat digunakan untuk melatih

kecermatan baca. Dibawah ini terdapat

beberapacontohkegiatansebagaiberikut:a)

Memperagakan , mintalah siswa untuk

membaca sebuah ceita. Kemudian mintalah

dia memperagakan cerita tersebut atau

memberiilustrasilain;b)Melengkapikalimat,

berikankepadanyakalimat-kalimatyang tak

lengkap.Mintasiswaituuntukmengisibagian

yang kosong dengan tulisan, gambar, atau

dengan cara lain; c)Melaksanakan Perintah,

berikan beberapa perintah secara tertulis.

Siswaharusmelaksanakanisiperintahitu.Ia

membaca perintah tersebut,kemudian

melaksanakannya; d) Mengisikan Kata,

buatkanbeberapakalimatyangtidaklengkap.

Siswamembacakalimat-kalimattersebutdan

harus mengisi bagian yang kosong. Cara

mengisi dapat dilakukan secara lisan,

tulisan,mengisikan kartu kata, atau me-

nempelkan gambar sesuai dengan maksud

kalimat; e) Mengelompokkan Kalimat,

tentukanduabahanpembicaraanataulebih.

Buat beberapa kalimat mengenai tiap-tiap

bahan tersebut,ditulis pada karton-karton

yang terpisah satu sama lain. Minta siswa

mengaduk-aduk kartu-kartu itu kemudian

mengelompokkannya menurut bahan pem-

bicaraan tadi; f) Pertanyaan tentang isi

bacaan. nintalah siswa membaca sesuatu,

setelah itu berilah pertanyaan-pertanyaan

mengenai isinya. Pertanyaan-pertanyaan

dapat diberikan secara lisan, tertulis dan

sebagainya;g)MembuatIlustrasi,mintasiswa

membacasesuatu,iaharusmembuatilustrasi

mengenai isi bacaan tersebut. Misalnya :

membuat gambar,membuat contoh,dan

sebagainya; h) Teka-teki, buatlah teka-teki

secaratertulis,berikankepadasiswa,mintalah

siswa menjawabnya; i) Menyusun Cerita,

pilihlah cerita yang pendek,tulislah kalimat-

kalimatnya pada kartu-kartu yang terpisah

satu sama lain,setiap kartu memuat satu

kalimat, campurkan kartu-kartu tersebut.

minta siswa menyusunnya menjadi cerita

yang utuh: j) Menjodohkan gambar dengan

cerita,pilihlahbeberapaceritayangpendek-

pendek,tulis tiap-tiap cerita pada sehelai

kertasyangterpisah;setiaphelaimemuatsatu

cerita. buatlah gambar mengenai tiap-tiap

ceritadanaduklahgambar-gambaritu.Tugas

siswa ialah membaca cerita-cerita tersebut

dan memasang gambar yang ada pada

adukan,pada cerita yang bersangkutan

dengangembartersebut.

Rencana perbaikan pembelajaran

Bahasa Indonesia dilaksanakan di kelas VB

SDN 001 Batam Kota. Jadwal pelaksanaan

pembelajaran adalah sebagai berikut: 1)

Tanggal 20 September 2018, 2) Tanggal 25

Oktober2018,3)Tanggal06Desember2018.

Adapun langkah-langkah yang di-

tempuh dalam perbaikan pembelajaran

Bahasa Indonesia siklus pertama adalah

sebagai berikut: 1) Membuat rencana per-

Page 53: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

52 53

berpikirgurutersebut,3)Penulismemahami

bahwapolaberpikir siswaSDbergerakdari

hal-halyangbersifatabstrakatautidaknyata.

Penerapan Strategi “KKB” sebagai

Solusi Penanaman Aspek Membaca Cepat.

Membacacepattermasukkategorimembaca

lanjutdandiajarkandikelastinggiyaitumulai

kelas 4. Masalah yang ditemukan dalam

membaca dibagi menjadi tiga kelompok

berdasarkanKecepatandanKecermatanBaca

( KKB ) : a) Membaca cepat tetapi kurang

cermat,b)Membacalambattetapicermat,c)

Membacalambatdankurangcermat.

Ada beberapa hal yang dapat

mengakibatkankurangcermatnyamembaca:

1) Pengamatan Siswa. Siswa yang ceroboh

dalammengamatihuruf,sukukata,kata,titik,

koma, dan sebagainya, akan kurang

penangkapannya, bahkan mungkin salah

tafsir, terkadangmerekamelewatikatayang

penting.Misalnya:SiDididibacaDidi.Bajunya

tidakputihdibacabajunyaputih;2)Perhatian

siswawaktusedangmembaca.Perhatiananak

tidak mustahil melayang kemana-mana.

Dalam berhitung, pembelokan perhatian itu

tampak jelas sebab menghasilkan jawaban

yangsalah.Tetapidalampelajaranmembaca

seringtidaknampakkeluar.Apabilaperhatian

tidak tertuju kepada bacaan, tentu tidak

menangkap apa yang dibacanya; 3) Siswa

kurang menangkap rangkaian kata. Yang

mereka baca hanyalah kata-kata satu demi

satu secara terpisah. Hal ini pun me-

ngakibatkantakdapatmenangkapisibacaan;

4) Penyebab lain adalah tidakmengerti apa

artikata.Siswayangsedikitperbendaharaan

katanya tak akan dapatmenangkapmaksud

penulis;5)Kebiasaanmembacadengansuara

keras. Akibatnya kurang memusatkan per-

hatian pada isi bacaan; 6) Kekurangcepatan

membaca, hal ini disebabkan oleh beberapa

hal.Salahsatudiantaranyaialahterlaluhati-

hati menganalisa tulisan. Siswa yang tidak

yakin bahwa suatu kata berbunyi orang,

menganalisa kata tersebut menjadi huruf-

huruf yang berdiri sendiri sebelum mem-

bacanya. Jadi : orang. demikian pula halnya

siswayangtidakyakindengankata-katalain;

7) Hal lain yang mengakibatkan lambatnya

membaca ialah reaksi mental. Siswa yang

lambat reaksi mentalnya akan lambat pula

membacanya; 8) Penyebab lain ialah

kebiasaankomatkamitwaktumembaca,atau

membayangkanbunyinnyadalamhati.

Apabila hal-hal yang mengakibatkan

kurangcermatmembacahadirbersama-sama

dalam diri seorang siswa. Maka siswa itu

menjadilambatmembacadankurangcermat.

Olehkarenaitupenulisinginmengangkatatau

memaparkanbagaimana“MemotivasiMinat

Baca Siswa ( M2BS ) dengan pendekatan

strategi“KKB”sebagailangkahmelatihsiswa.

PenerapanStrategi“KKB”terdiridari

dua langkah latihan, yaitu : a) Latihan

KecepatanBaca,b)LatihanKecermatanBaca.

Latihan Kecepatan Baca. Kartu Kalimat,

tulislah kalimat-kalimat pada kartu-kartu

atau kertas panjang. Setiap kartu hanya

memuat satu kalimat. Kalimat-kalimat

tersebutdapatdibagitigakelompok:kalimat

berita, kalimat Tanya, dan kalimat perintah.

Perlihatkankartu-kartutersebutdalamwaktu

yang sangat singkat.Bila yangdiperlihatkan

itu kalimat berita, minta siswa membaca

kalimat tersebut dengan hanya melihatnya

sebentar. Jika kalimatnya kalimat Tanya,

mintalahsiswamenjawabnya.Jikakalimatnya

kalimat perintahmintalah siswamelakukan

perintahyangadadidalamnya;2)Mengisikan

Kata. ambillah beberapa kalimat dari buku

bacaannya sehari-hari. Tulislah tiap-tiap

kalimat pada sehelai karton panjang.

Kosongkan salah satu kata pada setiap

kalimat.Tunjukkankalimat-kalimat tersebut

satudemisatu,masing-masingdalamwaktu

yangsingkat.Tugassiswaialahmenyebutkan

kata yang seharusnya ada pada tempat

kosong; 3) Kutipan Mencari Ungkapan.

kutiplahpadapapantulisbeberapaungkapan

yang diambil dari buku yang belum pernah

dibacasiswa.Mintalahsiswamembacabuku

yang dikutip tersebut.ia harus mencari

ungkapan tersebut pada buku-buku itu; 4)

Membaca Cepat, mintalah siswa membaca

bahan yang sangat sederhana dalam waktu

yang telah ditentukan. Kecepatan baca akan

diketahui dari jawaban atas pertanyaan-

pertanyaanmengenaibahantersebut.

Latihan Kecermatan Baca, Beberapa

kegiatan dapat digunakan untuk melatih

kecermatan baca. Dibawah ini terdapat

beberapacontohkegiatansebagaiberikut:a)

Memperagakan , mintalah siswa untuk

membaca sebuah ceita. Kemudian mintalah

dia memperagakan cerita tersebut atau

memberiilustrasilain;b)Melengkapikalimat,

berikankepadanyakalimat-kalimatyang tak

lengkap.Mintasiswaituuntukmengisibagian

yang kosong dengan tulisan, gambar, atau

dengan cara lain; c)Melaksanakan Perintah,

berikan beberapa perintah secara tertulis.

Siswaharusmelaksanakanisiperintahitu.Ia

membaca perintah tersebut,kemudian

melaksanakannya; d) Mengisikan Kata,

buatkanbeberapakalimatyangtidaklengkap.

Siswamembacakalimat-kalimattersebutdan

harus mengisi bagian yang kosong. Cara

mengisi dapat dilakukan secara lisan,

tulisan,mengisikan kartu kata, atau me-

nempelkan gambar sesuai dengan maksud

kalimat; e) Mengelompokkan Kalimat,

tentukanduabahanpembicaraanataulebih.

Buat beberapa kalimat mengenai tiap-tiap

bahan tersebut,ditulis pada karton-karton

yang terpisah satu sama lain. Minta siswa

mengaduk-aduk kartu-kartu itu kemudian

mengelompokkannya menurut bahan pem-

bicaraan tadi; f) Pertanyaan tentang isi

bacaan. nintalah siswa membaca sesuatu,

setelah itu berilah pertanyaan-pertanyaan

mengenai isinya. Pertanyaan-pertanyaan

dapat diberikan secara lisan, tertulis dan

sebagainya;g)MembuatIlustrasi,mintasiswa

membacasesuatu,iaharusmembuatilustrasi

mengenai isi bacaan tersebut. Misalnya :

membuat gambar,membuat contoh,dan

sebagainya; h) Teka-teki, buatlah teka-teki

secaratertulis,berikankepadasiswa,mintalah

siswa menjawabnya; i) Menyusun Cerita,

pilihlah cerita yang pendek,tulislah kalimat-

kalimatnya pada kartu-kartu yang terpisah

satu sama lain,setiap kartu memuat satu

kalimat, campurkan kartu-kartu tersebut.

minta siswa menyusunnya menjadi cerita

yang utuh: j) Menjodohkan gambar dengan

cerita,pilihlahbeberapaceritayangpendek-

pendek,tulis tiap-tiap cerita pada sehelai

kertasyangterpisah;setiaphelaimemuatsatu

cerita. buatlah gambar mengenai tiap-tiap

ceritadanaduklahgambar-gambaritu.Tugas

siswa ialah membaca cerita-cerita tersebut

dan memasang gambar yang ada pada

adukan,pada cerita yang bersangkutan

dengangembartersebut.

Rencana perbaikan pembelajaran

Bahasa Indonesia dilaksanakan di kelas VB

SDN 001 Batam Kota. Jadwal pelaksanaan

pembelajaran adalah sebagai berikut: 1)

Tanggal 20 September 2018, 2) Tanggal 25

Oktober2018,3)Tanggal06Desember2018.

Adapun langkah-langkah yang di-

tempuh dalam perbaikan pembelajaran

Bahasa Indonesia siklus pertama adalah

sebagai berikut: 1) Membuat rencana per-

Page 54: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

54 55

baikan pembelajaran pertama dengan

langkahkegiatan:a)Memutarkanvideohasil

rekaman acara lomba Porseni (lomba puisi

danpidato),b)Menceritakantentangprestasi

kakak kelas yang pernah diraih oleh kakak

kelas. Sebagai rangsangan untuk menarik

minat siswa. Memberi penjelasan kepada

siswa tentang tujuan pembelajaran Bahasa

Indonesia (membaca cepat) tersebut,

kemudian menghubungkan dengan kondisi

alam/lingkunganKotaBatamagarpelajaran

tersebut bermakna bagi kehidupan sehari-

hari, c) Memberi tugas rumah kepada

siswa,menontonberitayangdisiarkanmelalui

berbagai stasiun televisi, baikTVRImaupun

TV swasta; 2) Menyiapkan fasilitas atau

sarana pendukung yang diperlukan,

diantaranya : VCD, CD, TV,Handy Cam, atau

Laptop; 3) Menyediakan alat untuk

menyampaikan materi diantaranya : kartu

kalimat,kartukata,dansebagainya.

Sesua i dengan masa lah yang

dihadapi,yaitubenyaknyasiswayangkurang

berminat terhadap membaca khususnya

(membcacepat),makakegiatanyangmenjadi

perhatian khusus di dalam perbaikan

pembelajaran pertama ini adalah tentang

bagaimanamemotivasiminatbacasiswa.

Berikutinihasilpengamatandannilai

yang diperoleh dari hasil perbaikan pada

pembelajaran siklus pertama (lihat tabel 2

siklus1) sikluskedua (tabel3 siklus2)dan

siklusketiga(tabel4siklus3).Setelahpenulis

melakukan perbaikan pada pembelajaran

Bahasa Indonesia pada tahap pertama ini

sudah ada kemajuan walaupun belum

sepenuhnyasepertiyangdiharapkan.Namun

setelahdiadakanperbaikanulangpadasiklus

kedua dan ketiga melalui strategi M2BS

dengan pendekatan KKB,ternyata siswa

menunjukkan peningkatan yang cukup

signi�ikan.

Dilihat dari tabel pengamatan dan

tabelhasilbelajarpadasikluspertama,69,7%

sikluskedua72,7%dansiklusketiga87,9%.

Siswa telah mencapai tingkat keberhasilan

lebihdari70%.Halinidapatdiperolehdari

hasil penerapan strategi M2BS dengan

pendekatan KKB,sebagai teknik penyajian

materi.

Sesuai teori Gestaly yaitu hukum

Praknamz yang lebih berarti “Teratur,

Seimbang, Harmonis, artinya belajar me-

rupakanupayamencariataumenemukandari

suatu yang dipelajari” (Buku Perencanaan

Pengajaran).Untukmenemukankonsepatau

mater i yang d i terapkan ,d iper lukan

pemahaman. Ini didukung lagi dengan teori

ErnestHigard.Adaenamciridaribelajaryang

mengandung pemahaman yaitu: 1) Pe-

mahaman dipengaruhi oleh kemampuan

dasar, 2) Pemahaman dipengaruhi oleh

pengalamanbelajaryanglalu,3)Pemahaman

tergantung pada pengaturan situasi, 4)

Pemahamandidahuluiolehusahacoba-coba,

5)Belajardenganpemahamandapatdiulang,

6)Suatupemahamandapatdiaplikasikanlagi

bagipemahamansituasilain.

Dalam teori Gestaly guru tidak

memberikan sebagian-sebagian bahan ajar

tetapi selalu satu kesatuan dari segala

komponen yang berkaitan dalam proses

belajar mengajar dengan memperhatikan

strategi yang digunakan agar tujuan yang

diinginkantercapai.

Kermudian diperkuat lagi oleh teori

NaturalismeRomantikyangberasaldariJean

J.Rousseu. menurutnya siswa memiliki

potensiataukekuatanyangmasihterpendam

yaitu potensi berpikir, berperasaan,

berkemauan berkembang, mencari dan

menemukan sendiri apa yang diperlukan.

Melaluiberbagaibentukkegiatandanusaha

belajarsiswamengembangkansegalapotensi

yangdimilikinya.

Daripaparanteori-teoridiataspenulis

selalu belajar dan berusaha menemukan

bagaimana terbaik untuk menyampaikan

materi pada siswa sehingga siswa mudah

untuk mengerti. Dan dapat menemukan

sendiri kesulitan yang dihadapi. Efekti�itas

penggunaan media dan teknik KKB antara

lain: 1) Media yang digunakan sederhana

cukup menggunakan kartu kata. Kartu

kalimat,dangambar-gambaratauilustrasi,2)

Bahasa pengantarnya mudah dimengerti

siswa, 3) Semua siswa dapatmelakukannya

atau mempraktekkannya, 4) Antusias siswa

untukmengikutipelajarantinggi,5)Suasana

belajarjadimenyenangkan.

Demikianprosentasetentangstrategi

bagaimana memotivasi minat baca siswa

(M2BS) dengan pendekatan Kecepatan dan

Kecermatan Baca (KKB) yang dapat penulis

sampaikan semoga bermanfaat bagi kita

semua.

SIMPULAN DAN SARAN

Simpulan

Dari hasil perbaikan pembelajaran

Bahasa Indonesia yangmengangkat tentang

bagaimana Memotivasi Minat Baca Siswa

(M2BS) dengan pendekatan Kecepatan dan

Kecermatan Baca (KKB) dapat ditarik

beberapa kesimpulan : 1) Minat dapat

berkembangmelalui pengalaman belajar, 2)

Minat dapat memotivasi seseorang meraih

cita-cita, 3) Ajang kompetisi yang sering

diikuti siswa berpotensi dapat memotivasi

siswa-siswa lain untuk lebih giat belajar

khususnya membaca cepat, 4) Dalam

penerapan strategi pembelajaran yang

relevan, tentu mempermudah siswa

menguasai materi yang disajikan, 5)

Kemampuan dasar berbahasa sangat

membantu siswa berkomunikasi baik di

rumah,disekolah,maupundimasyarakat,6)

Strategi “M2BS” dengan pendekatan “KKB”

solusiuntukmengatasikesulitansiswadalam

menemukanaspekpembelajaran,7)Strategi

“M2BS” dengan pendekatan “KKB” penulis

anggap sangat efektif untuk siswa sekolah

dasarkarenamerekamembutuhkanstrategi

danmedianyata, 9)Bahasapengantarpada

strategi“KKB”inimudahdipahamisiswa,10)

Berhasilnya penerapan pendekatan “KKB”

semoga menuntun siswa mampu menyerap

perkembanganinformasiTeknologi(IT).

Saran

Berdasarkankesimpulandiatasperlu

beberapa hal yang sebaiknya dilakukan

seorang guru untuk meningkatkan hasil

belajar. Dan hendaknya juga mendapat

t a n g gapan d a r i p i h ak- p i h ak yang

berkompeten diantaranya: 1) Materi yang

disajikan perlu didukung oleh strategi dan

metodepembelajaranyangtepat,2)Sebelum

proses pembelajaran dimulai hendaknya

disiapkan alat yang dibutuhkan, 3) Seorang

guru hendaknya mampu membuat siswa

termotivasi dan berminat terhadap

pembelajaran membaca cepat agar hasil

belajarlebihmeningkat,4)Dalammemotivasi

minat baca siswa seorang guru professional

hendaknya memilih strategi dan media

pembelajaran yang tepat dan mudah

dimengertisiswa,5)Seorangguruhendaknya

mampu menciptakan suasana/lingkungan

belajar yang kondusif, 6) Agar menemukan

aspek materi yang disajikan,siswa perlu

bimbinganseorangguru,7)Siswayanglambat

dalambelajarhendaknyamendapatperhatian

lebih,8)SeorangKepalaSekolahhendaknya

Page 55: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

54 55

baikan pembelajaran pertama dengan

langkahkegiatan:a)Memutarkanvideohasil

rekaman acara lomba Porseni (lomba puisi

danpidato),b)Menceritakantentangprestasi

kakak kelas yang pernah diraih oleh kakak

kelas. Sebagai rangsangan untuk menarik

minat siswa. Memberi penjelasan kepada

siswa tentang tujuan pembelajaran Bahasa

Indonesia (membaca cepat) tersebut,

kemudian menghubungkan dengan kondisi

alam/lingkunganKotaBatamagarpelajaran

tersebut bermakna bagi kehidupan sehari-

hari, c) Memberi tugas rumah kepada

siswa,menontonberitayangdisiarkanmelalui

berbagai stasiun televisi, baikTVRImaupun

TV swasta; 2) Menyiapkan fasilitas atau

sarana pendukung yang diperlukan,

diantaranya : VCD, CD, TV,Handy Cam, atau

Laptop; 3) Menyediakan alat untuk

menyampaikan materi diantaranya : kartu

kalimat,kartukata,dansebagainya.

Sesua i dengan masa lah yang

dihadapi,yaitubenyaknyasiswayangkurang

berminat terhadap membaca khususnya

(membcacepat),makakegiatanyangmenjadi

perhatian khusus di dalam perbaikan

pembelajaran pertama ini adalah tentang

bagaimanamemotivasiminatbacasiswa.

Berikutinihasilpengamatandannilai

yang diperoleh dari hasil perbaikan pada

pembelajaran siklus pertama (lihat tabel 2

siklus1) sikluskedua (tabel3 siklus2)dan

siklusketiga(tabel4siklus3).Setelahpenulis

melakukan perbaikan pada pembelajaran

Bahasa Indonesia pada tahap pertama ini

sudah ada kemajuan walaupun belum

sepenuhnyasepertiyangdiharapkan.Namun

setelahdiadakanperbaikanulangpadasiklus

kedua dan ketiga melalui strategi M2BS

dengan pendekatan KKB,ternyata siswa

menunjukkan peningkatan yang cukup

signi�ikan.

Dilihat dari tabel pengamatan dan

tabelhasilbelajarpadasikluspertama,69,7%

sikluskedua72,7%dansiklusketiga87,9%.

Siswa telah mencapai tingkat keberhasilan

lebihdari70%.Halinidapatdiperolehdari

hasil penerapan strategi M2BS dengan

pendekatan KKB,sebagai teknik penyajian

materi.

Sesuai teori Gestaly yaitu hukum

Praknamz yang lebih berarti “Teratur,

Seimbang, Harmonis, artinya belajar me-

rupakanupayamencariataumenemukandari

suatu yang dipelajari” (Buku Perencanaan

Pengajaran).Untukmenemukankonsepatau

mater i yang d i terapkan ,d iper lukan

pemahaman. Ini didukung lagi dengan teori

ErnestHigard.Adaenamciridaribelajaryang

mengandung pemahaman yaitu: 1) Pe-

mahaman dipengaruhi oleh kemampuan

dasar, 2) Pemahaman dipengaruhi oleh

pengalamanbelajaryanglalu,3)Pemahaman

tergantung pada pengaturan situasi, 4)

Pemahamandidahuluiolehusahacoba-coba,

5)Belajardenganpemahamandapatdiulang,

6)Suatupemahamandapatdiaplikasikanlagi

bagipemahamansituasilain.

Dalam teori Gestaly guru tidak

memberikan sebagian-sebagian bahan ajar

tetapi selalu satu kesatuan dari segala

komponen yang berkaitan dalam proses

belajar mengajar dengan memperhatikan

strategi yang digunakan agar tujuan yang

diinginkantercapai.

Kermudian diperkuat lagi oleh teori

NaturalismeRomantikyangberasaldariJean

J.Rousseu. menurutnya siswa memiliki

potensiataukekuatanyangmasihterpendam

yaitu potensi berpikir, berperasaan,

berkemauan berkembang, mencari dan

menemukan sendiri apa yang diperlukan.

Melaluiberbagaibentukkegiatandanusaha

belajarsiswamengembangkansegalapotensi

yangdimilikinya.

Daripaparanteori-teoridiataspenulis

selalu belajar dan berusaha menemukan

bagaimana terbaik untuk menyampaikan

materi pada siswa sehingga siswa mudah

untuk mengerti. Dan dapat menemukan

sendiri kesulitan yang dihadapi. Efekti�itas

penggunaan media dan teknik KKB antara

lain: 1) Media yang digunakan sederhana

cukup menggunakan kartu kata. Kartu

kalimat,dangambar-gambaratauilustrasi,2)

Bahasa pengantarnya mudah dimengerti

siswa, 3) Semua siswa dapatmelakukannya

atau mempraktekkannya, 4) Antusias siswa

untukmengikutipelajarantinggi,5)Suasana

belajarjadimenyenangkan.

Demikianprosentasetentangstrategi

bagaimana memotivasi minat baca siswa

(M2BS) dengan pendekatan Kecepatan dan

Kecermatan Baca (KKB) yang dapat penulis

sampaikan semoga bermanfaat bagi kita

semua.

SIMPULAN DAN SARAN

Simpulan

Dari hasil perbaikan pembelajaran

Bahasa Indonesia yangmengangkat tentang

bagaimana Memotivasi Minat Baca Siswa

(M2BS) dengan pendekatan Kecepatan dan

Kecermatan Baca (KKB) dapat ditarik

beberapa kesimpulan : 1) Minat dapat

berkembangmelalui pengalaman belajar, 2)

Minat dapat memotivasi seseorang meraih

cita-cita, 3) Ajang kompetisi yang sering

diikuti siswa berpotensi dapat memotivasi

siswa-siswa lain untuk lebih giat belajar

khususnya membaca cepat, 4) Dalam

penerapan strategi pembelajaran yang

relevan, tentu mempermudah siswa

menguasai materi yang disajikan, 5)

Kemampuan dasar berbahasa sangat

membantu siswa berkomunikasi baik di

rumah,disekolah,maupundimasyarakat,6)

Strategi “M2BS” dengan pendekatan “KKB”

solusiuntukmengatasikesulitansiswadalam

menemukanaspekpembelajaran,7)Strategi

“M2BS” dengan pendekatan “KKB” penulis

anggap sangat efektif untuk siswa sekolah

dasarkarenamerekamembutuhkanstrategi

danmedianyata, 9)Bahasapengantarpada

strategi“KKB”inimudahdipahamisiswa,10)

Berhasilnya penerapan pendekatan “KKB”

semoga menuntun siswa mampu menyerap

perkembanganinformasiTeknologi(IT).

Saran

Berdasarkankesimpulandiatasperlu

beberapa hal yang sebaiknya dilakukan

seorang guru untuk meningkatkan hasil

belajar. Dan hendaknya juga mendapat

t a n g gapan d a r i p i h ak- p i h ak yang

berkompeten diantaranya: 1) Materi yang

disajikan perlu didukung oleh strategi dan

metodepembelajaranyangtepat,2)Sebelum

proses pembelajaran dimulai hendaknya

disiapkan alat yang dibutuhkan, 3) Seorang

guru hendaknya mampu membuat siswa

termotivasi dan berminat terhadap

pembelajaran membaca cepat agar hasil

belajarlebihmeningkat,4)Dalammemotivasi

minat baca siswa seorang guru professional

hendaknya memilih strategi dan media

pembelajaran yang tepat dan mudah

dimengertisiswa,5)Seorangguruhendaknya

mampu menciptakan suasana/lingkungan

belajar yang kondusif, 6) Agar menemukan

aspek materi yang disajikan,siswa perlu

bimbinganseorangguru,7)Siswayanglambat

dalambelajarhendaknyamendapatperhatian

lebih,8)SeorangKepalaSekolahhendaknya

Page 56: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

56 57

mampumenempatkanguruataubawahannya

pada tugasnya sesuai dengan disiplin ilmu

yang dikuasainya, 9) KKKS hendaknya

berusahamengakti�kanKelompokKerjaGuru

(KKG) pada gugus masing-masing untuk

membahaskendala-kendalayangditemukan

dalam proses pembelajaran, 10) Bagi dinas

terkait hendaknya meningkatkan frekuensi

pembinaan dan pelatihan guru agar lebih

professional sehingga melahirkan Sumber

DayaManusia(SDM)yangberkualitas.

Tabel2.NilaiHasilBelajarSiklus1

No

NamaSiswa

Nilai

KecepatanMembaca

Kecermatan

Membaca

JumlahNilai

Rata-rata

1 Adonis

Zul�ikaRuly 30

60

90

45

2 AlyNaufal

Fadhilah 50

80

130

65

3 AlyaNajwa

Azkia 70

70

140

70

4 AqlinaUlya

Zahida 80

90

170

85

5BagusAdjieSarwansyach

70 90 160 80

6BahrumEfendiHarahap

60 20 80 40

7ChelsieTresiaLumbanT.

60 40 100 50

8 CitraIndah 80 80 160 80 9 Dafa 70 90 160 80 10 DynaSovia 70 90 160 80

11JulianaNuraini

70 80 150 75

12KeysyaOktaLusianaS.

20 40 60 30

13 KeyzeeChen 60 90 150 75

14

KheneisyaSyakinaraMiranti

40

90

13065

15

MuhamadRisqy

Syahputra

70

70

14070

16

MuhammadAlhaa�idzS.

10

90

10050

17

MuhammadFairuzzabady

80

90

17085

18

MuhammadFaizNurhuda

70

90

160

80

19

MuhammadNurulHuda

20

90

110

55

No

NamaSiswa

Nilai

KecepatanMembaca

Kecermatan

Membaca

JumlahNilai

Rata-rata

20 Muhammad

Syarif 50

90

140

70

21 Raihan

Cahyono 40

80

120

60

22 SalwaAvrilia

Setiawan80

90

170

85

23ShaqaylaZa�itriAchmad

90 90 180 90

24 ShillaSazziah 40 90 130 65

25ZaskiaTiaraSya’bani

40 40 80 40

26 NabilaAzizah 70 70 140 70

27M.ArifMaulana

60 80 140 70

28

MutiaraNursalsabila

S

50 60 110 55

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

50

80

13065

31

DindaKhairunisa

70

20

90

45

32

Wendrian

50

80

13065

33

Kelly

70

80

15075

Rata-rata

58,79

74,55

66,67

Tabel3NilaiHasilBelajarSiklus2

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

1AdonisZul�ika

Ruly40 70 110 55

2AlyNaufalFadhilah

60 80 140 70

3AlyaNajwa

Azkia80 70 150 75

4AqlinaUlyaZahida

80 85 165 82,5

5BagusAdjieSarwansyach

70 90 160 80

6BahrumEfendi

Harahap60 30 90 45

7

ChelsieTresiaLumbanT.

60

40

100

50

8

CitraIndah

80

80

16080

9

Dafa

70

90

16080

10

DynaSovia

70

90

16080

11

JulianaNuraini

70

80

15075

12

KeysyaOktaLusianaS.

40

30

70

35

13

KeyzeeChen

60

90

150

75

14 Kheneisya

SyakinaraMiranti

40

90

13065

15 Muhamad

RisqySyahputra

90

60

15075

16 Muhammad

Alhaa�idzS. 30

90

120

60

17 Muhammad

Fairuzzabady80

90

170

85

18MuhammadFaizNurhuda

70 90 160 80

19MuhammadNurulHuda

30 90 120 60

20Muhammad

Syarif50 90 140 70

21RaihanCahyono

40 80 120 60

22SalwaAvriliaSetiawan

80 90 170 85

23ShaqaylaZa�itri

Achmad90 90 180 90

24

ShillaSazziah

50

90

14070

25

ZaskiaTiaraSya’bani

50

50

10050

26

NabilaAzizah

70

70

14070

27

M.ArifMaulana

70

80

15075

28

MutiaraNursalsabilaS

70

60

13065

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

60

80

140

70

31

DindaKhairunisa

70

20

90

45

32

Wendrian

50

80

130

65

33

Kelly

70

80

150

75

Rata-rata

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

Tabel4.NilaiHasilBelajarSiklus3

No NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

1AdonisZul�ika

Ruly50 70 120 60

2AlyNaufalFadhilah

70 80 150 75

3AlyaNajwa

Azkia80 70 150 75

6

BahrumEfendiHarahap

80

50

130

65

7

ChelsieTresiaLumbanT.

70

50

120

60

8

CitraIndah

90

80

170

85

9

Dafa

95

90

185

92,5

10

DynaSovia

80

90

170

85

11

JulianaNuraini

80

80

160

80

12

KeysyaOktaLusianaS.

60

60

12060

13

KeyzeeChen

90

90

18090

14 Kheneisya

SyakinaraMiranti

60

90

15075

15

MuhamadRisqy

Syahputra90

70

160

80

16MuhammadAlhaa�idzS.

50 90 140 70

17MuhammadFairuzzabady

90 90 180 90

18MuhammadFaizNurhuda

80 90 170 85

19MuhammadNurulHuda

60 90 150 75

20Muhammad

Syarif60 90 150 75

21

RaihanCahyono

60

80

140

70

22

SalwaAvriliaSetiawan

80

90

17085

23

ShaqaylaZa�itriAchmad

90

90

18090

24

ShillaSazziah

60

90

15075

25

ZaskiaTiaraSya’bani

60

80

140

70

26

NabilaAzizah

70

70

140

70

27

M.ArifMaulana

70

80

150

75

28

MutiaraNursalsabilaS

70

60

130

65

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

70

80

150

75

31

DindaKhairunisa

70

60

130

65

32

Wendrian

50

80

130

65

33

Kelly

90

80

170

85

Rata-rata

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

Page 57: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

56 57

mampumenempatkanguruataubawahannya

pada tugasnya sesuai dengan disiplin ilmu

yang dikuasainya, 9) KKKS hendaknya

berusahamengakti�kanKelompokKerjaGuru

(KKG) pada gugus masing-masing untuk

membahaskendala-kendalayangditemukan

dalam proses pembelajaran, 10) Bagi dinas

terkait hendaknya meningkatkan frekuensi

pembinaan dan pelatihan guru agar lebih

professional sehingga melahirkan Sumber

DayaManusia(SDM)yangberkualitas.

Tabel2.NilaiHasilBelajarSiklus1

No

NamaSiswa

Nilai

KecepatanMembaca

Kecermatan

Membaca

JumlahNilai

Rata-rata

1 Adonis

Zul�ikaRuly 30

60

90

45

2 AlyNaufal

Fadhilah 50

80

130

65

3 AlyaNajwa

Azkia 70

70

140

70

4 AqlinaUlya

Zahida 80

90

170

85

5BagusAdjieSarwansyach

70 90 160 80

6BahrumEfendiHarahap

60 20 80 40

7ChelsieTresiaLumbanT.

60 40 100 50

8 CitraIndah 80 80 160 80 9 Dafa 70 90 160 80 10 DynaSovia 70 90 160 80

11JulianaNuraini

70 80 150 75

12KeysyaOktaLusianaS.

20 40 60 30

13 KeyzeeChen 60 90 150 75

14

KheneisyaSyakinaraMiranti

40

90

13065

15

MuhamadRisqy

Syahputra

70

70

14070

16

MuhammadAlhaa�idzS.

10

90

10050

17

MuhammadFairuzzabady

80

90

17085

18

MuhammadFaizNurhuda

70

90

160

80

19

MuhammadNurulHuda

20

90

110

55

No

NamaSiswa

Nilai

KecepatanMembaca

Kecermatan

Membaca

JumlahNilai

Rata-rata

20 Muhammad

Syarif 50

90

140

70

21 Raihan

Cahyono 40

80

120

60

22 SalwaAvrilia

Setiawan80

90

170

85

23ShaqaylaZa�itriAchmad

90 90 180 90

24 ShillaSazziah 40 90 130 65

25ZaskiaTiaraSya’bani

40 40 80 40

26 NabilaAzizah 70 70 140 70

27M.ArifMaulana

60 80 140 70

28

MutiaraNursalsabila

S

50 60 110 55

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

50

80

13065

31

DindaKhairunisa

70

20

90

45

32

Wendrian

50

80

13065

33

Kelly

70

80

15075

Rata-rata

58,79

74,55

66,67

Tabel3NilaiHasilBelajarSiklus2

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

1AdonisZul�ika

Ruly40 70 110 55

2AlyNaufalFadhilah

60 80 140 70

3AlyaNajwa

Azkia80 70 150 75

4AqlinaUlyaZahida

80 85 165 82,5

5BagusAdjieSarwansyach

70 90 160 80

6BahrumEfendi

Harahap60 30 90 45

7

ChelsieTresiaLumbanT.

60

40

100

50

8

CitraIndah

80

80

16080

9

Dafa

70

90

16080

10

DynaSovia

70

90

16080

11

JulianaNuraini

70

80

15075

12

KeysyaOktaLusianaS.

40

30

70

35

13

KeyzeeChen

60

90

150

75

14 Kheneisya

SyakinaraMiranti

40

90

13065

15 Muhamad

RisqySyahputra

90

60

15075

16 Muhammad

Alhaa�idzS. 30

90

120

60

17 Muhammad

Fairuzzabady80

90

170

85

18MuhammadFaizNurhuda

70 90 160 80

19MuhammadNurulHuda

30 90 120 60

20Muhammad

Syarif50 90 140 70

21RaihanCahyono

40 80 120 60

22SalwaAvriliaSetiawan

80 90 170 85

23ShaqaylaZa�itri

Achmad90 90 180 90

24

ShillaSazziah

50

90

14070

25

ZaskiaTiaraSya’bani

50

50

10050

26

NabilaAzizah

70

70

14070

27

M.ArifMaulana

70

80

15075

28

MutiaraNursalsabilaS

70

60

13065

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

60

80

140

70

31

DindaKhairunisa

70

20

90

45

32

Wendrian

50

80

130

65

33

Kelly

70

80

150

75

Rata-rata

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

Tabel4.NilaiHasilBelajarSiklus3

No NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

1AdonisZul�ika

Ruly50 70 120 60

2AlyNaufalFadhilah

70 80 150 75

3AlyaNajwa

Azkia80 70 150 75

6

BahrumEfendiHarahap

80

50

130

65

7

ChelsieTresiaLumbanT.

70

50

120

60

8

CitraIndah

90

80

170

85

9

Dafa

95

90

185

92,5

10

DynaSovia

80

90

170

85

11

JulianaNuraini

80

80

160

80

12

KeysyaOktaLusianaS.

60

60

12060

13

KeyzeeChen

90

90

18090

14 Kheneisya

SyakinaraMiranti

60

90

15075

15

MuhamadRisqy

Syahputra90

70

160

80

16MuhammadAlhaa�idzS.

50 90 140 70

17MuhammadFairuzzabady

90 90 180 90

18MuhammadFaizNurhuda

80 90 170 85

19MuhammadNurulHuda

60 90 150 75

20Muhammad

Syarif60 90 150 75

21

RaihanCahyono

60

80

140

70

22

SalwaAvriliaSetiawan

80

90

17085

23

ShaqaylaZa�itriAchmad

90

90

18090

24

ShillaSazziah

60

90

15075

25

ZaskiaTiaraSya’bani

60

80

140

70

26

NabilaAzizah

70

70

140

70

27

M.ArifMaulana

70

80

150

75

28

MutiaraNursalsabilaS

70

60

130

65

29

AngelicaStarlaA

80

90

170

85

30

FharizOkkyR

70

80

150

75

31

DindaKhairunisa

70

60

130

65

32

Wendrian

50

80

130

65

33

Kelly

90

80

170

85

Rata-rata

No

NamaSiswa

Nilai

KecepatanMembaca

KecermatanMembaca

JumlahNilai

Rata-rata

Page 58: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

58 59

DAFTARPUSTAKA

A. Wahyudin, D. Supriyadi, Ishak Abdullah,2002. Pengantar Pendidikan, Jakarta:UniversitasTerbuka.

Heriawan Asep, dkk, 2003. PengembanganKurikulum Pembelajaran, Jakarta :UniversitasTerbuka.

Ibrahim, Nana Syaudih, 1993. PerencanaanPengajaran,Riau:UNRI

Johnson Elaine B.P.HD, 2007. ContextualTeaching & Learning, Terjemahan,Bandung:MLC.

MikarsaHeraLestari,AgusTau�ik,PujiLestariPriantoro, 2002. Pendidikan di SD,Jakarta:UniversitasTerbuka.

Puj i Santosa , dkk , 2007. Mater i DanPembelajaran Bahasa Indonesia SD,Jakarta:UniversitasTerbuka.

Soeprapto, Rochman Natawidjaja, 1980.Pengajaran Remedial dalam Bahasa,Jakarta:BalaiPustaka.

Sumantri Mulyani, Nana Syaodih, 2005.PerkembanganPesertaDidik,Jakarta:UniversitasTerbuka.

S u p r a y e k t i , 2 0 0 4 . P e m b a h a r u a nPembelajaran, Jakarta: UniversitasTerbuka.

Surya H. M, dkk, 2002. Kapita SelektaKependidikanSD,Jakarta:UniversitasTerbuka.

WardaniJ.G.A.K,JulehaS,MarsinahN,2001.Pemantapan Kemampuan ProfesionalGuru,Jakarta:UniversitasTerbuka.

Wardani,I.G.A.K.KuswayuW.NoehiN,2004.Penelitian Tindakan Kelas, Jakarta :UniversitasTerbuka.

MENTORINGPEMECAHANMASALAH(MSP)BELAJARSISWAMELALUIGURUDANORANGTUA

ImamEdhiPriyanto*

Abstrak:Dalamkegiatanbelajarmengajaryangdilakukangurudikelasselaluakandijumpaiproblematikbelajarsiswa.Masalahbelajarsiswayangadakarakteristiknyaberbeda-beda.Namundalampenangannyacenderungmenghakimisiswadanmenjadikanmasalahbaruyangmengakibatkanperseteruanantaragurudansiswayangberkepanjangan.Tulisaninibertujuanmemberikanalternatifpemecahanmasalahbelajarsiswa agar hasilnya lebih komprehensif dan optimal. Mengatasi masalah belajar siswa seharusnyamemperhatikankarakteristiksiswa,masalah,danakarbudayanya.Denganmemperhatikansecaraseksamamakametodepemecahanmasalahakantepatdanhasilnyaoptimal.Penelitian inimenggunakanmetodestudi pustaka, wawancara dengan guru, dan pengalaman empiris dilapangan. Oleh karena itu dalammemecahkanmasalahpermasalahbelajarsiswainidigunakanmetodementoringterhadapgurudanorangtuasiswadalammemecahkanmasalahbelajarsiswaatauanaknya.Hasildarikegiatanmentoringpemecahanmasalah(Mentoring belajarsiswaolehgurudanorangtuasiswayaitusebagaiSolutiontoProblem=MSP) berikut:a)MSPterhadapgurupemulaberdampakpadakeberhasilanpemecahanmasalahsiswanyadanb)MSP terhadap guru yang cukup lama dan senior berdampak pada keberhasilan pemecahan masalahsiswanya.Sebagaikesimpulandalamkajianinimenunjukanbahwa:a)sumbermasalahsiswaberasaldariinternal dan eksternal dan b) guru ataupun orang tua siswa dalam memecahkan masalah siswanyamemerlukankegiatanmentoringdaripihakyanglebihkompeten,sepertikepala/wakilsekolah,pengawassekolah,widyaiswara,ataupundosen.

Katakunci:mentoringdanpemecahanmasalahbelajarsiswa

PENDAHULUAN

Dalamkegiatanbelajarmengajaryang

dilakukangurudikelasselaluakandijumpai

problematik belajar siswanya. Guru sebagai

seorang profesional maka harus bisa

mempelajari karakteristik belajar setiap

siswanya. Dalam merencanakan pem-

belajaran dapat menyesuaikan dengan

penggunaan metode, media belajar, pe-

ngaturanwaktu,KompetensiDasar(KD)atau

materi yang akan di pelajari serta

karakteristiksiswanya.

Dari hasil wawancara dengan guru-

guru penyegaran bimbingan teknis K13

Tahun2019jenjangSMPdanSDpadatanggal

20dan24Maret 2019,menunjukkan setiap

guru dalam merencanakan pembelajaran

kurang memperhatikan karakteristik sis-

wanya tapi lebih menekankan karakteristik

KDnya. Ini menunjukan kebutuhan belajar

setiap siswa belum menjadi perhatian yang

utama tapi lebih mengutamakan target

kurikulum. Oleh karena itu dalam kegiatan

pembelajaran di kelas yang terjadi, siswa

mengikuti kegiatan belajar karena terpaksa

dan bukan karena kebutuhan. Maka iklim

belajar yang terjadi sebagian siswa yang

kurangcocokmerasakegiatanyangmenyiksa

atau tidakmenyenangkan.Dengandemikian

siswa dalam belajar cenderung bukan

mengalamitapikarenatekanandarigurudan

jikatidakmengikutituntutangurumakasiswa

dikategorikankurangbaik.

Kondisisiswabelajarkarenatekanan

dan tuntutan guru cenderung tingkat

pemahaman konsep KD yang dipelajari

rendah. Maka ketika guru menguji ke-

mampuan siswa dalam penguasaan KD

melaluipenilaianharianmasihbanyaksiswa

yang belum tuntas. Pada kenyataan ini

menunjukansiswamempunyaipermasalahan

belajar. Diantarapermasalahanbelajarsiswa

yangdapatdenganmudahkitajumpaidalam

setiap sekolah adalah siswa dengan hasil

belajarnyarendah.

Page 59: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

58 59

DAFTARPUSTAKA

A. Wahyudin, D. Supriyadi, Ishak Abdullah,2002. Pengantar Pendidikan, Jakarta:UniversitasTerbuka.

Heriawan Asep, dkk, 2003. PengembanganKurikulum Pembelajaran, Jakarta :UniversitasTerbuka.

Ibrahim, Nana Syaudih, 1993. PerencanaanPengajaran,Riau:UNRI

Johnson Elaine B.P.HD, 2007. ContextualTeaching & Learning, Terjemahan,Bandung:MLC.

MikarsaHeraLestari,AgusTau�ik,PujiLestariPriantoro, 2002. Pendidikan di SD,Jakarta:UniversitasTerbuka.

Puj i Santosa , dkk , 2007. Mater i DanPembelajaran Bahasa Indonesia SD,Jakarta:UniversitasTerbuka.

Soeprapto, Rochman Natawidjaja, 1980.Pengajaran Remedial dalam Bahasa,Jakarta:BalaiPustaka.

Sumantri Mulyani, Nana Syaodih, 2005.PerkembanganPesertaDidik,Jakarta:UniversitasTerbuka.

S u p r a y e k t i , 2 0 0 4 . P e m b a h a r u a nPembelajaran, Jakarta: UniversitasTerbuka.

Surya H. M, dkk, 2002. Kapita SelektaKependidikanSD,Jakarta:UniversitasTerbuka.

WardaniJ.G.A.K,JulehaS,MarsinahN,2001.Pemantapan Kemampuan ProfesionalGuru,Jakarta:UniversitasTerbuka.

Wardani,I.G.A.K.KuswayuW.NoehiN,2004.Penelitian Tindakan Kelas, Jakarta :UniversitasTerbuka.

MENTORINGPEMECAHANMASALAH(MSP)BELAJARSISWAMELALUIGURUDANORANGTUA

ImamEdhiPriyanto*

Abstrak:Dalamkegiatanbelajarmengajaryangdilakukangurudikelasselaluakandijumpaiproblematikbelajarsiswa.Masalahbelajarsiswayangadakarakteristiknyaberbeda-beda.Namundalampenangannyacenderungmenghakimisiswadanmenjadikanmasalahbaruyangmengakibatkanperseteruanantaragurudansiswayangberkepanjangan.Tulisaninibertujuanmemberikanalternatifpemecahanmasalahbelajarsiswa agar hasilnya lebih komprehensif dan optimal. Mengatasi masalah belajar siswa seharusnyamemperhatikankarakteristiksiswa,masalah,danakarbudayanya.Denganmemperhatikansecaraseksamamakametodepemecahanmasalahakantepatdanhasilnyaoptimal.Penelitian inimenggunakanmetodestudi pustaka, wawancara dengan guru, dan pengalaman empiris dilapangan. Oleh karena itu dalammemecahkanmasalahpermasalahbelajarsiswainidigunakanmetodementoringterhadapgurudanorangtuasiswadalammemecahkanmasalahbelajarsiswaatauanaknya.Hasildarikegiatanmentoringpemecahanmasalah(Mentoring belajarsiswaolehgurudanorangtuasiswayaitusebagaiSolutiontoProblem=MSP) berikut:a)MSPterhadapgurupemulaberdampakpadakeberhasilanpemecahanmasalahsiswanyadanb)MSP terhadap guru yang cukup lama dan senior berdampak pada keberhasilan pemecahan masalahsiswanya.Sebagaikesimpulandalamkajianinimenunjukanbahwa:a)sumbermasalahsiswaberasaldariinternal dan eksternal dan b) guru ataupun orang tua siswa dalam memecahkan masalah siswanyamemerlukankegiatanmentoringdaripihakyanglebihkompeten,sepertikepala/wakilsekolah,pengawassekolah,widyaiswara,ataupundosen.

Katakunci:mentoringdanpemecahanmasalahbelajarsiswa

PENDAHULUAN

Dalamkegiatanbelajarmengajaryang

dilakukangurudikelasselaluakandijumpai

problematik belajar siswanya. Guru sebagai

seorang profesional maka harus bisa

mempelajari karakteristik belajar setiap

siswanya. Dalam merencanakan pem-

belajaran dapat menyesuaikan dengan

penggunaan metode, media belajar, pe-

ngaturanwaktu,KompetensiDasar(KD)atau

materi yang akan di pelajari serta

karakteristiksiswanya.

Dari hasil wawancara dengan guru-

guru penyegaran bimbingan teknis K13

Tahun2019jenjangSMPdanSDpadatanggal

20dan24Maret 2019,menunjukkan setiap

guru dalam merencanakan pembelajaran

kurang memperhatikan karakteristik sis-

wanya tapi lebih menekankan karakteristik

KDnya. Ini menunjukan kebutuhan belajar

setiap siswa belum menjadi perhatian yang

utama tapi lebih mengutamakan target

kurikulum. Oleh karena itu dalam kegiatan

pembelajaran di kelas yang terjadi, siswa

mengikuti kegiatan belajar karena terpaksa

dan bukan karena kebutuhan. Maka iklim

belajar yang terjadi sebagian siswa yang

kurangcocokmerasakegiatanyangmenyiksa

atau tidakmenyenangkan.Dengandemikian

siswa dalam belajar cenderung bukan

mengalamitapikarenatekanandarigurudan

jikatidakmengikutituntutangurumakasiswa

dikategorikankurangbaik.

Kondisisiswabelajarkarenatekanan

dan tuntutan guru cenderung tingkat

pemahaman konsep KD yang dipelajari

rendah. Maka ketika guru menguji ke-

mampuan siswa dalam penguasaan KD

melaluipenilaianharianmasihbanyaksiswa

yang belum tuntas. Pada kenyataan ini

menunjukansiswamempunyaipermasalahan

belajar. Diantarapermasalahanbelajarsiswa

yangdapatdenganmudahkitajumpaidalam

setiap sekolah adalah siswa dengan hasil

belajarnyarendah.

Page 60: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

60 61

Siswa mempunyai hasil belajar

rendahpenyebabnyamungkinkarenakurang

kesiapan diri siswa dalam belajar, kurang

senang terhadap mata pelajaran tersebut,

penyajianpembelajaranyangkurangmenarik

bagisiswa,danlainsebagainya.Olehkarena

itupenyebabrendahnyaprestaisiswaituada

banyakhal.Jikahalinidibiarkanmenjadikan

siswa semakin menjauhi minat belajar dan

pada akhirnya siswa dapat mengalami

kesulitanbelajar.

Usaha untuk melayani dan mem-

berikanbimbinganterhadapsiswaagartepat

guna, maka perlu dilakukan diagnosis

kesulitanbelajar.Diagnosiskesulitanbelajar

siswamerupakansebagaisegalausahayang

dilakukan guru untuk memahami dengan

menetapkanjenisdansifatkesulitanbelajar,

mempelajari faktor-faktor yang menye-

babkan kesulitan belajar, dan cara me-

netapkan dan kemungkinan mengatasinya,

baik secara kuratif (penyembuhan)maupun

secara preventif (pencegahan) berdasarkan

datadaninformasiyangseobyektifmungkin.

Kegiatan diagnosis dapat dikla-

si�ikasikan menjadi dua macam, yaitu

diagnosis untuk mengerti masalah dan

diagnosis yang mengklasi�ikasi masalah.

Diagnosis untuk mengerti masalah me-

rupakan usaha untuk dapat lebih banyak

mengerti masalah secara menyeluruh.

Sedangkan diagnosis yang mengklasi�ikasi

masalah merupakan pengelompokan

masalah sesuai ragam dan sifatnya. Ada

masalahyangdigolongkankedalammasalah

yang bersifat vokasional, pendidikan,

keuangan, kesehatan, keluarga dan ke-

pribadian. Kesulitan belajar merupakan

problem yang nyaris dialami oleh semua

siswa.Kesulitanbelajardapatdiartikansuatu

kondisi dalam proses belajar yang ditandai

adanya hambatan-hambatan tertentu untuk

menggapaihasilbelajar.

Kehidupanparapesertadidikternyata

sangatberagam,yaitu :1) adayangnormal

dapat mengikuti sesuai dengan per-

kembangan psikologi peserta didik dan

lingkungannya, yang artinya pencapaian

prestasi adakemis dan kehidupan peserta

didik dapat mencapai optimal; 2) ada yang

sebagiannormaldansebagiantidaknormal,

yang artinya pencapaian prestasi adakemis

dan kehidupan peserta didik hanya dapat

mencapai tingkat sedang; dan 3) ada yang

sebagianbesaratauseluruhnyatidaknormal,

yang artinya pencapaian prestasi adakemis

dan kehidupan peserta didik tingkat

pencapaiannyarendah.

Dari uraian diatas maka dalam

memecahkan persoalan kesulitan belajar

maka diperlukan tindakan guru yang dapat

memecahkan masalah belajar siswa yang

melalui prosedur yang benar. Untuk hal itu

maka guru perlu melakukan pemecahan

masalah belajar siswanya. Agar hasil yang

diperoleh lebih komprehensif dan optimal

makapemecahanmasalahsiswatidakhanya

dilakukanolehgurutetapijugaorangtuanya.

Guru dan orang tua siswa mempunyai

keterbatasan dalam pemecahan masalah

siswanya atau anaknya maka diperlukan

adanya mentoring oleh yang tenaga yang

kompeten seperti tenaga bimbingan

penyuluhan dan konseling (BPK) kompeten

yangberkelanjutan.

Tujuan pembahasan ini adalah

sebagai berikut: 1) Mengidenti�ikasi

permasalahan kesulitan pembelajaran; 2)

Mengkaji berbagai persoalan tentang

permasalahan belajar; 3) Mengidenti�ikasi

alternatif mengatasi permasalahan pem-

belajaran; 4) Memberikan mentoring guru

dan orang tua siswa dalam pemecahan

masalah pembelajaran siswanya secara

komperhensif dan optimal . Manfaat

pembahasn ini yaitu untuk: 1)Mengungkap

persoalanbelajarsiswadalamkeseharian;2)

Mengungkap cara pemecahan masalah

belajardalamkeseharian;3)Mentoringguru

dalammemecahkanpersoalanpembelajaran

siswanya.Ruanglingkupdalampenulisanini

yaitu tentang masalah belajar serta cara

memecahkan masalah belajar dengan

mentoring.

PEMBAHASAN

KesulitanBelajarSiswa

Hamalik (1983), mengemukakan

bahwa kesulitan belajar adalah hal-hal atau

gangguan yang mengakibatkan kegagalan

atausetidaknyamenjadigangguanyangdapat

menghambat kemajuan belajar. Rumini dkk

dalam Irham dan Wiyani (2013), me-

ngemukakan bahwa kesulitan belajar

merupakan kondisi saat siswa mengalami

hambatan-hambatan tertentu untuk me-

ngikuti proses pembelajaran dan mencapai

hasilbelajarsecaraoptimal.

Dalam kegiatan pembelajaran di

sekolah,kitadihadapkandenganganguandan

kondisi siswa yang beragam karak-

terisktiknya. Ada siswa yang dapat me-

nempuh kegiatan belajarnya secara lancar

dan berhasil tanpa mengalami kesulitan,

namundisisilaintidaksedikitpulasiswayang

justrudalambelajarnyamengalamiberbagai

kesulitan.Kesulitanbelajarsiswaditunjukkan

oleh adanya hambatan-hambatan tertentu

untuk mencapai hasil belajar, dan dapat

bersifat psikologis, sosiologis, maupun

�isiologis, sehingga pada akhirnya dapat

menyebabkan prestasi belajar yang di-

capainyaberadadibawahsemestinya.

Jenis-JenisMasalahBelajarSiswa

Kesulitan belajar siswa mencakup

pengertian yang luas, diantaranya : a)

gangguan belajar (learning disorder); b)

disfungsibelajar (learningdisfunction);c)di

bawahpencapaian(underachiever);d)siswa

lambat (slow learner), dan e) belajar

berkebutuhankhusus(learningdiasbilities).Di

bawahiniakandiuraikandarimasing-masing

pengertian tersebut. Pertama, Learning

Disorder atau kekacauan belajar adalah

keadaan dimana proses belajar seseorang

terganggu karena timbulnya respon yang

bertentangan.Padadasarnyayangmengalami

kekacauan belajar potensi dasarnya tidak

dirugikan, akan tetapi belajarnya terganggu

atau terhambat oleh adanya respon-respon

yang bertentangan, sehingga hasil belajar

yang dicapainya lebih rendah dari potensi

yang dimilikinya. Contoh: siswa yang sudah

terbiasadenganolahragakerassepertikarate,

tinju dan sejenisnya, mungkin akan me-

ngalamikesulitandalambelajarmenariyang

menuntutgerakanlemah-gemulai.

Kedua, Learning Disfunction me-

rupakan gejala dimana proses belajar yang

dilakukansiswatidakberfungsidenganbaik,

meskipun sebenarnya siswa tersebut tidak

menunjukkan adanya subnormalitasmental,

gangguanalatdria,ataugangguanpsikologis

lainnya. Contoh: siswa yang yang memiliki

postur tubuh yang tinggi atletis dan sangat

cocokmenjadiatletbolavoli,namunkarena

tidakpernahdilatihbermainbolavoli,maka

dia tidak dapat menguasai permainan voli

denganbaik.

Ketiga, Under Achiever mengacu

kepada siswa yang sesungguhnya memiliki

tingkatpotensi intelektualyang tergolongdi

atas normal, tetapi prestasi belajarnya

tergolong rendah. Contoh: siswa yang telah

Page 61: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

60 61

Siswa mempunyai hasil belajar

rendahpenyebabnyamungkinkarenakurang

kesiapan diri siswa dalam belajar, kurang

senang terhadap mata pelajaran tersebut,

penyajianpembelajaranyangkurangmenarik

bagisiswa,danlainsebagainya.Olehkarena

itupenyebabrendahnyaprestaisiswaituada

banyakhal.Jikahalinidibiarkanmenjadikan

siswa semakin menjauhi minat belajar dan

pada akhirnya siswa dapat mengalami

kesulitanbelajar.

Usaha untuk melayani dan mem-

berikanbimbinganterhadapsiswaagartepat

guna, maka perlu dilakukan diagnosis

kesulitanbelajar.Diagnosiskesulitanbelajar

siswamerupakansebagaisegalausahayang

dilakukan guru untuk memahami dengan

menetapkanjenisdansifatkesulitanbelajar,

mempelajari faktor-faktor yang menye-

babkan kesulitan belajar, dan cara me-

netapkan dan kemungkinan mengatasinya,

baik secara kuratif (penyembuhan)maupun

secara preventif (pencegahan) berdasarkan

datadaninformasiyangseobyektifmungkin.

Kegiatan diagnosis dapat dikla-

si�ikasikan menjadi dua macam, yaitu

diagnosis untuk mengerti masalah dan

diagnosis yang mengklasi�ikasi masalah.

Diagnosis untuk mengerti masalah me-

rupakan usaha untuk dapat lebih banyak

mengerti masalah secara menyeluruh.

Sedangkan diagnosis yang mengklasi�ikasi

masalah merupakan pengelompokan

masalah sesuai ragam dan sifatnya. Ada

masalahyangdigolongkankedalammasalah

yang bersifat vokasional, pendidikan,

keuangan, kesehatan, keluarga dan ke-

pribadian. Kesulitan belajar merupakan

problem yang nyaris dialami oleh semua

siswa.Kesulitanbelajardapatdiartikansuatu

kondisi dalam proses belajar yang ditandai

adanya hambatan-hambatan tertentu untuk

menggapaihasilbelajar.

Kehidupanparapesertadidikternyata

sangatberagam,yaitu :1) adayangnormal

dapat mengikuti sesuai dengan per-

kembangan psikologi peserta didik dan

lingkungannya, yang artinya pencapaian

prestasi adakemis dan kehidupan peserta

didik dapat mencapai optimal; 2) ada yang

sebagiannormaldansebagiantidaknormal,

yang artinya pencapaian prestasi adakemis

dan kehidupan peserta didik hanya dapat

mencapai tingkat sedang; dan 3) ada yang

sebagianbesaratauseluruhnyatidaknormal,

yang artinya pencapaian prestasi adakemis

dan kehidupan peserta didik tingkat

pencapaiannyarendah.

Dari uraian diatas maka dalam

memecahkan persoalan kesulitan belajar

maka diperlukan tindakan guru yang dapat

memecahkan masalah belajar siswa yang

melalui prosedur yang benar. Untuk hal itu

maka guru perlu melakukan pemecahan

masalah belajar siswanya. Agar hasil yang

diperoleh lebih komprehensif dan optimal

makapemecahanmasalahsiswatidakhanya

dilakukanolehgurutetapijugaorangtuanya.

Guru dan orang tua siswa mempunyai

keterbatasan dalam pemecahan masalah

siswanya atau anaknya maka diperlukan

adanya mentoring oleh yang tenaga yang

kompeten seperti tenaga bimbingan

penyuluhan dan konseling (BPK) kompeten

yangberkelanjutan.

Tujuan pembahasan ini adalah

sebagai berikut: 1) Mengidenti�ikasi

permasalahan kesulitan pembelajaran; 2)

Mengkaji berbagai persoalan tentang

permasalahan belajar; 3) Mengidenti�ikasi

alternatif mengatasi permasalahan pem-

belajaran; 4) Memberikan mentoring guru

dan orang tua siswa dalam pemecahan

masalah pembelajaran siswanya secara

komperhensif dan optimal . Manfaat

pembahasn ini yaitu untuk: 1)Mengungkap

persoalanbelajarsiswadalamkeseharian;2)

Mengungkap cara pemecahan masalah

belajardalamkeseharian;3)Mentoringguru

dalammemecahkanpersoalanpembelajaran

siswanya.Ruanglingkupdalampenulisanini

yaitu tentang masalah belajar serta cara

memecahkan masalah belajar dengan

mentoring.

PEMBAHASAN

KesulitanBelajarSiswa

Hamalik (1983), mengemukakan

bahwa kesulitan belajar adalah hal-hal atau

gangguan yang mengakibatkan kegagalan

atausetidaknyamenjadigangguanyangdapat

menghambat kemajuan belajar. Rumini dkk

dalam Irham dan Wiyani (2013), me-

ngemukakan bahwa kesulitan belajar

merupakan kondisi saat siswa mengalami

hambatan-hambatan tertentu untuk me-

ngikuti proses pembelajaran dan mencapai

hasilbelajarsecaraoptimal.

Dalam kegiatan pembelajaran di

sekolah,kitadihadapkandenganganguandan

kondisi siswa yang beragam karak-

terisktiknya. Ada siswa yang dapat me-

nempuh kegiatan belajarnya secara lancar

dan berhasil tanpa mengalami kesulitan,

namundisisilaintidaksedikitpulasiswayang

justrudalambelajarnyamengalamiberbagai

kesulitan.Kesulitanbelajarsiswaditunjukkan

oleh adanya hambatan-hambatan tertentu

untuk mencapai hasil belajar, dan dapat

bersifat psikologis, sosiologis, maupun

�isiologis, sehingga pada akhirnya dapat

menyebabkan prestasi belajar yang di-

capainyaberadadibawahsemestinya.

Jenis-JenisMasalahBelajarSiswa

Kesulitan belajar siswa mencakup

pengertian yang luas, diantaranya : a)

gangguan belajar (learning disorder); b)

disfungsibelajar (learningdisfunction);c)di

bawahpencapaian(underachiever);d)siswa

lambat (slow learner), dan e) belajar

berkebutuhankhusus(learningdiasbilities).Di

bawahiniakandiuraikandarimasing-masing

pengertian tersebut. Pertama, Learning

Disorder atau kekacauan belajar adalah

keadaan dimana proses belajar seseorang

terganggu karena timbulnya respon yang

bertentangan.Padadasarnyayangmengalami

kekacauan belajar potensi dasarnya tidak

dirugikan, akan tetapi belajarnya terganggu

atau terhambat oleh adanya respon-respon

yang bertentangan, sehingga hasil belajar

yang dicapainya lebih rendah dari potensi

yang dimilikinya. Contoh: siswa yang sudah

terbiasadenganolahragakerassepertikarate,

tinju dan sejenisnya, mungkin akan me-

ngalamikesulitandalambelajarmenariyang

menuntutgerakanlemah-gemulai.

Kedua, Learning Disfunction me-

rupakan gejala dimana proses belajar yang

dilakukansiswatidakberfungsidenganbaik,

meskipun sebenarnya siswa tersebut tidak

menunjukkan adanya subnormalitasmental,

gangguanalatdria,ataugangguanpsikologis

lainnya. Contoh: siswa yang yang memiliki

postur tubuh yang tinggi atletis dan sangat

cocokmenjadiatletbolavoli,namunkarena

tidakpernahdilatihbermainbolavoli,maka

dia tidak dapat menguasai permainan voli

denganbaik.

Ketiga, Under Achiever mengacu

kepada siswa yang sesungguhnya memiliki

tingkatpotensi intelektualyang tergolongdi

atas normal, tetapi prestasi belajarnya

tergolong rendah. Contoh: siswa yang telah

Page 62: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

62 63

dites kecerdasannya dan menunjukkan

tingkat kecerdasan tergolong sangat unggul

(IQ=130–140),namunprestasibelajarnya

biasa-biasasajaataumalahsangatrendah.

Keempat, Slow Learner atau lambat

belajar adalah siswa yang lambat dalam

proses belajar, sehingga ia membutuhkan

waktu yang lebih lama dibandingkan

sekelompok siswa lain yang memiliki taraf

potensi intelektual yang sama. Kelima,

Learning Disabilities atau ketidakmampuan

belajar mengacu pada gejala dimana siswa

tidak mampu belajar atau menghindari

belajar, sehingga hasil belajar di bawah

potensiintelektualnya.

Siswa yang mengalami kesulitan

belajarsepertitergolongdalampengertiandi

atas akan tampak dari berbagai gejala yang

dimanifestasikan dalam perilakunya, baik

aspekpsikomotorik,kognitif,konatifmaupun

afektif. Beberapa perilaku yang merupakan

manifestasi gejala kesulitan belajar, antara

lain: 1) Menunjukkan hasil belajar yang

rendahdibawahrata-ratanilaiyangdicapai

olehkelompoknyaataudibawahpotensiyang

dimilikinya; 2) Hasil yang dicapai tidak

seimbangdenganusahayangtelahdilakukan.

Mungkinadasiswayangsudahberusahagiat

belajar, tapi nilai yang diperolehnya selalu

rendah; 3) Lambat dalammelakukan tugas-

tugas kegiatan belajarnya dan selalu

tertinggal dari kawan-kawannya dari waktu

yangdisediakan;4)Menunjukkansikap-sikap

yang tidak wajar, seperti: acuh tak acuh,

menentang, berpura-pura, dusta dan

sebagainya; 5) Menunjukkan perilaku yang

berkelainan, seperti membolos, datang

terlambat, tidak mengerjakan pekerjaan

rumah,mengganggudidalamataupundiluar

kelas, tidak mau mencatat pelajaran, tidak

teratur dalam kegiatan belajar, dan

sebagainya; dan 6) Menunjukkan gejala

emosional yang kurang wajar, seperti:

pemurung, mudah tersinggung, pemarah,

tidakataukuranggembiradalammenghadapi

situasitertentu.Misalnyadalammenghadapi

nilai rendah, tidak menunjukkan perasaan

sedihataumenyesal,dansebagainya.

Sementara itu, Burton dalam Abin

Syamsuddin (2003), mengidenti�ikasi siswa

yang diduga mengalami kesulitan belajar

ditunjukkan oleh adanya kegagalan siswa

dalam mencapai tujuan-tujuan belajar.

Menurut dia bahwa siswa dikatakan gagal

dalambelajarapabila:1)Dalambataswaktu

tertentu yang bersangkutan tidak mencapai

ukuran tingkat keberhasilan atau tingkat

penguasaan materi (mastery level) minimal

dalam pelajaran tertentu yang telah

ditetapkanolehguru(criterionreference);2)

Tidak dapat mengerjakan atau mencapai

prestasi semestinya, dilihat berdasarkan

ukuran tingkat kemampuan, bakat, atau

kecerdasanyangdimilikinya.Siswainidapat

digolongkankedalamunderachiever;dan3)

Tidak berhasil tingkat penguasaan materi

(mastery level) yang diperlukan sebagai

prasyarat bagi kelanjutan tingkat pelajaran

berikutnya. Siswa ini dapat digolongkan ke

dalam slow learner atau belum matang

( immature), sehingga harus menjadi

pengulang(repeater).

P e n y e b a b y a n g m u n g k i n

mengakibatkan timbulnya kesulitan belajar

menurut Slameto (2003), yaitu: 1)Faktor

internal yang berasal dari dalam diri siswa,

yang meliputi kesehatan, keadaan jasmani

dan rohani, intelegensi, perhatian, bakat,

sikap,minatdanmotivasi;2)Faktoreksternal

yang berasal dari luar diri siswa, yang

meliputi:a.Lingkungankeluargyaitusuasana

rumah, keadaan ekonomi keluarga dan

perhatianorangtua,polahubunganorangtua

dengan anak, cara orang tua mendidik. b.

Lingkungan Sekolah, yang meliputi metode

guru mengajar, guru yang tidak quali�ied,

mediapembelajaran,hubungangurudengan

siswa, disiplin sekolah serta sarana dan

prasarana; c. Lingkungan masyarakat, yang

meliputi kegiatan siswa dalam masyarakat,

mediamassa, lingungan tetanggadan teman

bergaul.

Mentoring Pemecahan Masalah Belajar

Siswa

Mentoring menurut Smith dalam

Aiman Ghalib (2011), adalah suatu proses

interaksi antaramentor (individuyang lebih

berpengalaman) dengan mentee untuk

membantu mengembangkan beberapa hal

yangdiantaranyaadalahpengembangandiri,

pengetahuan dan memperbesar jaringan,

sertapencapaianprestasidankarir.Kegiatan

mentoring yaitu: a) hubungan dua arah,

interaktif,berbagiide,danhubungansukarela

yang berbasis saling menghormati dan

kepercayaan (sebuah sistem dukungan

proaktif); b) bersifat unik, personal dan

hubunganyangcukuppribadiberbedadengan

konsephubunganorangtua-anak;danc)suatu

jalan membantu siswa dalam menemukan

jalanhidupnya;berbedadenganmemberitahu

mereka apa yang harus dilakukan (telling

themwhattodo).

Dari uraian diatas maka dapat

disimpulkan bahwa kegiatan mentoring

merupakanbentukkegiatanpembinaanatau

pendampingan terhadap siswa dalam

memecahkan masalah belajarnya melalui

kegiatanrutinsiswadisekolahsertakegiatan

lain di luar sekolah. Pelaksanaanmentoring

pemecahan masalah (Mentoring Solution to

Problem = MSP), siswa yang terlibat akan

dibagi ke dalam kelompok- kelompok kecil.

Satu kelompok mentoring terdiri dari 6

sampai 8 orang yangdipimpinoleh seorang

pembimbing (mentor) dapat dari guru

sekolah yang bersangkutan atau pihak luar

sepertiorangtuasiswa.

Pertama, Mentoring Pemecahan

MasalahSiswaMelaluiGuru,Kesulitanbelajar

merupakan alam ketidakmampuan siswa d

menggunakan atau memaksimalkan fungsi

kemampuansecaraspesi�ik,contohnyatidak

sempurna dalam mengeja atau membaca.

Sehingga dibutuhkan cara belajar khusus

untuksiswayangmengalamikesulitanbelajar.

Berikutbeberapacarayangdapatdigunakan

oleh guru untukmembantu anakmengatasi

kesulitan belajar, yaitu: 1) Menggunakan

metode pembelajaran pengetahuan awal

(prior knowledge). Menggunakan metode

pembelajaran dengan mengakti�kan pe-

ngetahuan awal siswa yang sudah dimiliki

sebelumnya untukmempelajarimateri baru

yang masih berhubungan. Penggunaan

pengetahuan awal akanmemudahkan siswa

mengingatmateribarusesuaikonteksmateri

yang telah dipelajari sebelumnya. Pe-

ngetahuan awal salah satunya dapat

dilakukan dengan memberikan tugas

membaca materi di rumah yang akan

dipelajari esok hari; 2) Menggunakan pe-

metaanpikiran(mindmapping).Mengajarkan

kemampuan pembelajaran untuk belajar,

karena sebagian siswa dengan kesulitan

belajar tidak memiliki strategi yang baik

untuk belajar. Contohnya siswa dapat

diajarkanmembuatcatatan(mindmap)untuk

mempermudahsiswadalambelajar;3)Sering

memberikan umpan balik. Siswa dengan

kesulitanbelajarmemilikiketerbatasantidak

sanggup mengerjakan tugas atau belajar

dalam jangkawaktupanjang. Sehingga guru

Page 63: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

62 63

dites kecerdasannya dan menunjukkan

tingkat kecerdasan tergolong sangat unggul

(IQ=130–140),namunprestasibelajarnya

biasa-biasasajaataumalahsangatrendah.

Keempat, Slow Learner atau lambat

belajar adalah siswa yang lambat dalam

proses belajar, sehingga ia membutuhkan

waktu yang lebih lama dibandingkan

sekelompok siswa lain yang memiliki taraf

potensi intelektual yang sama. Kelima,

Learning Disabilities atau ketidakmampuan

belajar mengacu pada gejala dimana siswa

tidak mampu belajar atau menghindari

belajar, sehingga hasil belajar di bawah

potensiintelektualnya.

Siswa yang mengalami kesulitan

belajarsepertitergolongdalampengertiandi

atas akan tampak dari berbagai gejala yang

dimanifestasikan dalam perilakunya, baik

aspekpsikomotorik,kognitif,konatifmaupun

afektif. Beberapa perilaku yang merupakan

manifestasi gejala kesulitan belajar, antara

lain: 1) Menunjukkan hasil belajar yang

rendahdibawahrata-ratanilaiyangdicapai

olehkelompoknyaataudibawahpotensiyang

dimilikinya; 2) Hasil yang dicapai tidak

seimbangdenganusahayangtelahdilakukan.

Mungkinadasiswayangsudahberusahagiat

belajar, tapi nilai yang diperolehnya selalu

rendah; 3) Lambat dalammelakukan tugas-

tugas kegiatan belajarnya dan selalu

tertinggal dari kawan-kawannya dari waktu

yangdisediakan;4)Menunjukkansikap-sikap

yang tidak wajar, seperti: acuh tak acuh,

menentang, berpura-pura, dusta dan

sebagainya; 5) Menunjukkan perilaku yang

berkelainan, seperti membolos, datang

terlambat, tidak mengerjakan pekerjaan

rumah,mengganggudidalamataupundiluar

kelas, tidak mau mencatat pelajaran, tidak

teratur dalam kegiatan belajar, dan

sebagainya; dan 6) Menunjukkan gejala

emosional yang kurang wajar, seperti:

pemurung, mudah tersinggung, pemarah,

tidakataukuranggembiradalammenghadapi

situasitertentu.Misalnyadalammenghadapi

nilai rendah, tidak menunjukkan perasaan

sedihataumenyesal,dansebagainya.

Sementara itu, Burton dalam Abin

Syamsuddin (2003), mengidenti�ikasi siswa

yang diduga mengalami kesulitan belajar

ditunjukkan oleh adanya kegagalan siswa

dalam mencapai tujuan-tujuan belajar.

Menurut dia bahwa siswa dikatakan gagal

dalambelajarapabila:1)Dalambataswaktu

tertentu yang bersangkutan tidak mencapai

ukuran tingkat keberhasilan atau tingkat

penguasaan materi (mastery level) minimal

dalam pelajaran tertentu yang telah

ditetapkanolehguru(criterionreference);2)

Tidak dapat mengerjakan atau mencapai

prestasi semestinya, dilihat berdasarkan

ukuran tingkat kemampuan, bakat, atau

kecerdasanyangdimilikinya.Siswainidapat

digolongkankedalamunderachiever;dan3)

Tidak berhasil tingkat penguasaan materi

(mastery level) yang diperlukan sebagai

prasyarat bagi kelanjutan tingkat pelajaran

berikutnya. Siswa ini dapat digolongkan ke

dalam slow learner atau belum matang

( immature), sehingga harus menjadi

pengulang(repeater).

P e n y e b a b y a n g m u n g k i n

mengakibatkan timbulnya kesulitan belajar

menurut Slameto (2003), yaitu: 1)Faktor

internal yang berasal dari dalam diri siswa,

yang meliputi kesehatan, keadaan jasmani

dan rohani, intelegensi, perhatian, bakat,

sikap,minatdanmotivasi;2)Faktoreksternal

yang berasal dari luar diri siswa, yang

meliputi:a.Lingkungankeluargyaitusuasana

rumah, keadaan ekonomi keluarga dan

perhatianorangtua,polahubunganorangtua

dengan anak, cara orang tua mendidik. b.

Lingkungan Sekolah, yang meliputi metode

guru mengajar, guru yang tidak quali�ied,

mediapembelajaran,hubungangurudengan

siswa, disiplin sekolah serta sarana dan

prasarana; c. Lingkungan masyarakat, yang

meliputi kegiatan siswa dalam masyarakat,

mediamassa, lingungan tetanggadan teman

bergaul.

Mentoring Pemecahan Masalah Belajar

Siswa

Mentoring menurut Smith dalam

Aiman Ghalib (2011), adalah suatu proses

interaksi antaramentor (individuyang lebih

berpengalaman) dengan mentee untuk

membantu mengembangkan beberapa hal

yangdiantaranyaadalahpengembangandiri,

pengetahuan dan memperbesar jaringan,

sertapencapaianprestasidankarir.Kegiatan

mentoring yaitu: a) hubungan dua arah,

interaktif,berbagiide,danhubungansukarela

yang berbasis saling menghormati dan

kepercayaan (sebuah sistem dukungan

proaktif); b) bersifat unik, personal dan

hubunganyangcukuppribadiberbedadengan

konsephubunganorangtua-anak;danc)suatu

jalan membantu siswa dalam menemukan

jalanhidupnya;berbedadenganmemberitahu

mereka apa yang harus dilakukan (telling

themwhattodo).

Dari uraian diatas maka dapat

disimpulkan bahwa kegiatan mentoring

merupakanbentukkegiatanpembinaanatau

pendampingan terhadap siswa dalam

memecahkan masalah belajarnya melalui

kegiatanrutinsiswadisekolahsertakegiatan

lain di luar sekolah. Pelaksanaanmentoring

pemecahan masalah (Mentoring Solution to

Problem = MSP), siswa yang terlibat akan

dibagi ke dalam kelompok- kelompok kecil.

Satu kelompok mentoring terdiri dari 6

sampai 8 orang yangdipimpinoleh seorang

pembimbing (mentor) dapat dari guru

sekolah yang bersangkutan atau pihak luar

sepertiorangtuasiswa.

Pertama, Mentoring Pemecahan

MasalahSiswaMelaluiGuru,Kesulitanbelajar

merupakan alam ketidakmampuan siswa d

menggunakan atau memaksimalkan fungsi

kemampuansecaraspesi�ik,contohnyatidak

sempurna dalam mengeja atau membaca.

Sehingga dibutuhkan cara belajar khusus

untuksiswayangmengalamikesulitanbelajar.

Berikutbeberapacarayangdapatdigunakan

oleh guru untukmembantu anakmengatasi

kesulitan belajar, yaitu: 1) Menggunakan

metode pembelajaran pengetahuan awal

(prior knowledge). Menggunakan metode

pembelajaran dengan mengakti�kan pe-

ngetahuan awal siswa yang sudah dimiliki

sebelumnya untukmempelajarimateri baru

yang masih berhubungan. Penggunaan

pengetahuan awal akanmemudahkan siswa

mengingatmateribarusesuaikonteksmateri

yang telah dipelajari sebelumnya. Pe-

ngetahuan awal salah satunya dapat

dilakukan dengan memberikan tugas

membaca materi di rumah yang akan

dipelajari esok hari; 2) Menggunakan pe-

metaanpikiran(mindmapping).Mengajarkan

kemampuan pembelajaran untuk belajar,

karena sebagian siswa dengan kesulitan

belajar tidak memiliki strategi yang baik

untuk belajar. Contohnya siswa dapat

diajarkanmembuatcatatan(mindmap)untuk

mempermudahsiswadalambelajar;3)Sering

memberikan umpan balik. Siswa dengan

kesulitanbelajarmemilikiketerbatasantidak

sanggup mengerjakan tugas atau belajar

dalam jangkawaktupanjang. Sehingga guru

Page 64: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

64 65

disarankan untuk memberikan tugas yang

singkat dan konkret yang langsung diberi

nilai;4)Pembelajaranyangmelibatkansiswa

secara aktif. Menggunakan strategi pe-

ngajaranyangmelibatkansiswasecaraaktif

dalam pelajaran. Siswa dengan kesulitan

belajar cenderung berkinerja lebih baik jika

merekaterlibatsecaraaktifdalampelajaran.

Gurudapatmenggunakanmetodekooperatif

danproyekpraktis.Caramengatasikesulitan

belajar dengan melibatkan siswa ini me-

merlukan kesabaran dan keuletan guru; 5)

Pemantauan diri (self-monitoring) dengan

tujuan agar siswa mampu menjaga dan

mengontrol perilakunya yang dimunculkan.

Terdiridariduakomponenyaitu pematauan

evaluasi (self-evaluation) dan rekaman diri

(self-recording).Contohnya,siswayangtelah

menyelesaikan tugas matematika dapat

mengevaluasi pekerjaannya dengan melihat

jawaban benar dan melaporkan berapa

jawaban benar yang dia kerjakan. Setelah

beberapaharimenyelesaikanbeberapatugas

matematika, guru dan siswa dapat melihat

laporankemajuanbelajarmatematikasiswa.

Darisinigurudapatmengetahuiapakahsiswa

masih mengalami kesulitan di konsep

matematika tertentuatau tidak;6) Instruksi

perancah (scaffolded instruction). Guru

menyediakan asisten kepada siswa dalam

mempelajari materi atau tugas-tugas baru,

dan secara perlahan mengurangi kehadiran

asisten kepada anak sehingga anak dapat

belajarsecaramandiri;7)Pengajarantimbal

balik (reciprocal teaching). Reciprocal

teachingmeliputidialoginteraktifantaraguru

dansiswayangmemunculkanhubunganyang

lebih dekat antara siswa dan guru. Guru

memberikan bantuan dalam menyelesaikan

tugas dengan cara tahapan penyelesaian

tugas, namun guru memberikan kebebasan

kepada siswa untuk menggunakan asumsi

mereka sendiri dalammenyelesaikan tugas.

Cara mangatasi kesulitan belajar meng-

gunakan reciprocal teaching akan me-

ningkatkankedekatangurudengansiswanya,

sehingga siswa akan termotivasi untuk

menggali kemampuan dirinya. Contohnya

guru memberikan tugas membedakan

tumbuhan berkayu dan tidak berkayu, guru

bertanya pada siswa tumbuhan berkayu itu

seperti apa dan yang tidak berkayu seperti

apa.Kemudiansiswadiberikebebasanuntuk

menyebutkancontohdanmencariciri-cirilain

daritumbuhanberkayudantidakberkayu;8)

Instruksisecaralangsung(directinstruction).

Fokus kepada proses dari instruksi yang

disampaikan. Program ini dapat diterapkan

pada beberapa bidang akademis, seperti

membaca, berhitung, sains, sosial dan lain

sebagainya. Instruksi disampaikan dengan

langsungbertatapmukakepadasiswa,serta

dilakukan secara bertahap sesuai dengan

mater i yang akan d ipe la jar i ser ta

menekankanprogrampraktek(practice)dan

penyampaianmateriyangberulang(drill);9)

TutorSebaya(Peertutoring).Gurumenyusun

program pembelajaran dengan cara menge-

lompokkan siswa-siswa dalam beberapa

kelompok dan kemudianmenetapkan siswa

yangmemilikikemampuanyanglebihuntuk

membantu teman-teman yang lain dalam

memahami materi yang dipelajari. Be-

kerjasama dengan teman sekelas, dapat

meningkatkan keefektifan dalam belajar,

didukung oleh adanya kebebasan dalam

menyampaikanmaterisesuaidengananalogi

yang dimiliki dan tepat dengan tujuan

pembelajaran; 10) Instruksi diri (Self-

instruction). Gurumengajarkan siswa untuk

menyadari jenis-jenis pemecahan masalah

terhadap tugas-tugas yang dihadapi, ke-

mudian diaplikasikan dalam perilaku yang

dimunculkan tanpa dikontrol atau instruksi

secara verbal. Cara mengatasi kesulitan

belajar dengan self-instruction tepat

digunakanuntuksiswakelas5hingga6yang

mengalami kesulitan belajar. Terdapat 5

langkahdalammenerapkanself-instruction:a)

Mende�inisikan masalah : “Apa yang harus

sayalakukan?”;b)Rencana:“Bagaimanasaya

dapat menyelesaikan tugas ini?”; c)

Penggunaan strategi : “Lima tahap strategi

akan membantu saya mencari kata-kata

penting?”; d) Self-evaluation : “Bagaimana

tugas yang telah saya selesaikan?”; dan e)

Penguatan diri (Self-reinforcement) : “Kerja

bagus.Akudapatmenyelesaikantugasdengan

baik”;11)Modelpengirimanlayanan(Service

DeliveryModels). Dalam pelaksanaan proses

pembelajaran, siswa yang mengalami

kesulitan belajar ditempatkan pada satu

ruang khusus, sehingga siswa diberikan

metode dan materi khusus untuk mem-

fasilitasi siswa sepenuhnya dan mendorong

keinginansiswauntukbelajardenganserius.

Mentoring Pemecahan Masalah Be-

lajarSiswaMelaluiOrangtua,Orangtuadapat

berperanaktifdalammembimbingsiswayang

memiliki kesulitan belajar. Peran orangtua

diharapkan dapat membantu guru dalam

mengetahuicaraterbaikuntukmengajarkan

pendidikan pada anak. Berikut ini beberapa

peranyangbisadilakukanolehorangtua:1)

Menjalin komunikasi dengan guru kelas.

Orangtua dapat mengetahui dimana ke-

mampuandankesulitanyangdialamianak;2)

Mengulang materi pelajaran yang telah

diberikandisekolah;3)Kepekaanorangtua

terhadap kondisi anak, tidak menuntut

berlebihandiluarbatasankemampuanyang

dimiliki anak, dan juga tidak mengabaikan

anakataskelemahanyangterdapatdalamdiri

anak. Karena harapan orangtua yang terlalu

tinggi pada kemampuan anak justru akan

menjadi anak tertekandanakanberdampak

lebih buruk; 4)Berikanmotivasi pada anak.

Walaupun kemajuan kemampuan seperti

membaca, menulis atau berhitung lebih

lambatdariteman-temanyanglain,yakinkan

anakbahwamerekapastibisamenyelesaikan

tugas sekolah dengan baik; 5) Hindari

membandingkan anak dengan saudara

ataupun dengan teman yang lain; 6)

Mendampingi anak ketika belajar agar anak

lebihmudahbertanyaataumemintabantuan

ketikamengalamikesulitan.

SIMPULANDANSARAN

Simpulan

Kesulitanbelajar adalahhal-hal atau

gangguan belajar yang mengakibatkan

kegagalanatausetidaknyamenjadigangguan

yang dapat menghambat kemajuan belajar.

Dimana dalam kesulitan belajar siswa

mencakuppengertianyangluas,diantaranya:

(a)gangguan belajar (learning disorder); (b)

disfungsibelajar(learningdisfunction);(c)di

bawahpencapaian(underachiever);(d)siswa

lambat (slow learner), dan (e) belajar

berkebutuhankhusus(learningdiasbilities).

Adapun faktor penyebab kesulitan

belajar siswa, yaitu : 1. Faktor internal yang

berasal dari dalamdiri siswa, yangmeliputi

kesehatan, keadaan jasmani dan rohani,

intelegensi,perhatian,bakat,sikap,minatdan

motivasi;2.Faktoreksternalyangberasaldari

luardirisiswa.

Mentoring adalah suatu proses

interaksi antaramentor (individu yang lebih

berpengalaman) dengan mentee untuk

membantu mengembangkan beberapa hal

yangdiantaranyaadalahpengembangandiri,

pengetahuan dan memperbesar jaringan,

Page 65: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

64 65

disarankan untuk memberikan tugas yang

singkat dan konkret yang langsung diberi

nilai;4)Pembelajaranyangmelibatkansiswa

secara aktif. Menggunakan strategi pe-

ngajaranyangmelibatkansiswasecaraaktif

dalam pelajaran. Siswa dengan kesulitan

belajar cenderung berkinerja lebih baik jika

merekaterlibatsecaraaktifdalampelajaran.

Gurudapatmenggunakanmetodekooperatif

danproyekpraktis.Caramengatasikesulitan

belajar dengan melibatkan siswa ini me-

merlukan kesabaran dan keuletan guru; 5)

Pemantauan diri (self-monitoring) dengan

tujuan agar siswa mampu menjaga dan

mengontrol perilakunya yang dimunculkan.

Terdiridariduakomponenyaitu pematauan

evaluasi (self-evaluation) dan rekaman diri

(self-recording).Contohnya,siswayangtelah

menyelesaikan tugas matematika dapat

mengevaluasi pekerjaannya dengan melihat

jawaban benar dan melaporkan berapa

jawaban benar yang dia kerjakan. Setelah

beberapaharimenyelesaikanbeberapatugas

matematika, guru dan siswa dapat melihat

laporankemajuanbelajarmatematikasiswa.

Darisinigurudapatmengetahuiapakahsiswa

masih mengalami kesulitan di konsep

matematika tertentuatau tidak;6) Instruksi

perancah (scaffolded instruction). Guru

menyediakan asisten kepada siswa dalam

mempelajari materi atau tugas-tugas baru,

dan secara perlahan mengurangi kehadiran

asisten kepada anak sehingga anak dapat

belajarsecaramandiri;7)Pengajarantimbal

balik (reciprocal teaching). Reciprocal

teachingmeliputidialoginteraktifantaraguru

dansiswayangmemunculkanhubunganyang

lebih dekat antara siswa dan guru. Guru

memberikan bantuan dalam menyelesaikan

tugas dengan cara tahapan penyelesaian

tugas, namun guru memberikan kebebasan

kepada siswa untuk menggunakan asumsi

mereka sendiri dalammenyelesaikan tugas.

Cara mangatasi kesulitan belajar meng-

gunakan reciprocal teaching akan me-

ningkatkankedekatangurudengansiswanya,

sehingga siswa akan termotivasi untuk

menggali kemampuan dirinya. Contohnya

guru memberikan tugas membedakan

tumbuhan berkayu dan tidak berkayu, guru

bertanya pada siswa tumbuhan berkayu itu

seperti apa dan yang tidak berkayu seperti

apa.Kemudiansiswadiberikebebasanuntuk

menyebutkancontohdanmencariciri-cirilain

daritumbuhanberkayudantidakberkayu;8)

Instruksisecaralangsung(directinstruction).

Fokus kepada proses dari instruksi yang

disampaikan. Program ini dapat diterapkan

pada beberapa bidang akademis, seperti

membaca, berhitung, sains, sosial dan lain

sebagainya. Instruksi disampaikan dengan

langsungbertatapmukakepadasiswa,serta

dilakukan secara bertahap sesuai dengan

mater i yang akan d ipe la jar i ser ta

menekankanprogrampraktek(practice)dan

penyampaianmateriyangberulang(drill);9)

TutorSebaya(Peertutoring).Gurumenyusun

program pembelajaran dengan cara menge-

lompokkan siswa-siswa dalam beberapa

kelompok dan kemudianmenetapkan siswa

yangmemilikikemampuanyanglebihuntuk

membantu teman-teman yang lain dalam

memahami materi yang dipelajari. Be-

kerjasama dengan teman sekelas, dapat

meningkatkan keefektifan dalam belajar,

didukung oleh adanya kebebasan dalam

menyampaikanmaterisesuaidengananalogi

yang dimiliki dan tepat dengan tujuan

pembelajaran; 10) Instruksi diri (Self-

instruction). Gurumengajarkan siswa untuk

menyadari jenis-jenis pemecahan masalah

terhadap tugas-tugas yang dihadapi, ke-

mudian diaplikasikan dalam perilaku yang

dimunculkan tanpa dikontrol atau instruksi

secara verbal. Cara mengatasi kesulitan

belajar dengan self-instruction tepat

digunakanuntuksiswakelas5hingga6yang

mengalami kesulitan belajar. Terdapat 5

langkahdalammenerapkanself-instruction:a)

Mende�inisikan masalah : “Apa yang harus

sayalakukan?”;b)Rencana:“Bagaimanasaya

dapat menyelesaikan tugas ini?”; c)

Penggunaan strategi : “Lima tahap strategi

akan membantu saya mencari kata-kata

penting?”; d) Self-evaluation : “Bagaimana

tugas yang telah saya selesaikan?”; dan e)

Penguatan diri (Self-reinforcement) : “Kerja

bagus.Akudapatmenyelesaikantugasdengan

baik”;11)Modelpengirimanlayanan(Service

DeliveryModels). Dalam pelaksanaan proses

pembelajaran, siswa yang mengalami

kesulitan belajar ditempatkan pada satu

ruang khusus, sehingga siswa diberikan

metode dan materi khusus untuk mem-

fasilitasi siswa sepenuhnya dan mendorong

keinginansiswauntukbelajardenganserius.

Mentoring Pemecahan Masalah Be-

lajarSiswaMelaluiOrangtua,Orangtuadapat

berperanaktifdalammembimbingsiswayang

memiliki kesulitan belajar. Peran orangtua

diharapkan dapat membantu guru dalam

mengetahuicaraterbaikuntukmengajarkan

pendidikan pada anak. Berikut ini beberapa

peranyangbisadilakukanolehorangtua:1)

Menjalin komunikasi dengan guru kelas.

Orangtua dapat mengetahui dimana ke-

mampuandankesulitanyangdialamianak;2)

Mengulang materi pelajaran yang telah

diberikandisekolah;3)Kepekaanorangtua

terhadap kondisi anak, tidak menuntut

berlebihandiluarbatasankemampuanyang

dimiliki anak, dan juga tidak mengabaikan

anakataskelemahanyangterdapatdalamdiri

anak. Karena harapan orangtua yang terlalu

tinggi pada kemampuan anak justru akan

menjadi anak tertekandanakanberdampak

lebih buruk; 4)Berikanmotivasi pada anak.

Walaupun kemajuan kemampuan seperti

membaca, menulis atau berhitung lebih

lambatdariteman-temanyanglain,yakinkan

anakbahwamerekapastibisamenyelesaikan

tugas sekolah dengan baik; 5) Hindari

membandingkan anak dengan saudara

ataupun dengan teman yang lain; 6)

Mendampingi anak ketika belajar agar anak

lebihmudahbertanyaataumemintabantuan

ketikamengalamikesulitan.

SIMPULANDANSARAN

Simpulan

Kesulitanbelajar adalahhal-hal atau

gangguan belajar yang mengakibatkan

kegagalanatausetidaknyamenjadigangguan

yang dapat menghambat kemajuan belajar.

Dimana dalam kesulitan belajar siswa

mencakuppengertianyangluas,diantaranya:

(a)gangguan belajar (learning disorder); (b)

disfungsibelajar(learningdisfunction);(c)di

bawahpencapaian(underachiever);(d)siswa

lambat (slow learner), dan (e) belajar

berkebutuhankhusus(learningdiasbilities).

Adapun faktor penyebab kesulitan

belajar siswa, yaitu : 1. Faktor internal yang

berasal dari dalamdiri siswa, yangmeliputi

kesehatan, keadaan jasmani dan rohani,

intelegensi,perhatian,bakat,sikap,minatdan

motivasi;2.Faktoreksternalyangberasaldari

luardirisiswa.

Mentoring adalah suatu proses

interaksi antaramentor (individu yang lebih

berpengalaman) dengan mentee untuk

membantu mengembangkan beberapa hal

yangdiantaranyaadalahpengembangandiri,

pengetahuan dan memperbesar jaringan,

Page 66: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

66 67

serta pencapaian prestasi dan karir. Dalam

pemecahanmasalahbelajarsiswadilakukan

denganmentoring oleh guru dan orang tua

siswa.Denganmentoringpemecahanmasalah

siswa oleh guru dan orang tua siswa maka

hasilnyaakankomperhensipdanoptimal.

Saran

Pemecahan masalah belajar siswa

akan lebih efektif jika dilakukan dengan

memperhatikan karakteristik masalah,

siswanya, dan akar budayanya. Pemecahan

masalah tersebut d i lakukan secara

terprogram dan berkelanjutan. Jikamasalah

yang diatasi pada diri siswa juga tidak

mengalami perubahan maka bias juga

menggunakan pihak yang kompeten seperti

psikater.

DAFTAR PUSTAKA

AbinSyamsuddin,2003.PsikologiPendidikan.Bandung:PTRemajaRosdaKarya

E. Mulyasa, 2003. Kurikulum BerbasisKompetensi.Konsep;KarakteristikdanImplementasi. Bandung: P.T. RemajaRosdakarya.

…………...., 2004. Implementasi Kurikulum2004; Panduan Pembelajaran KBK.Bandung:P.T.RemajaRosdakarya.

Kusmoro. 2017, Problematika ImplementasiK13 Tahun 2016. Pontianak: BuletinReviu,LPMPKalbar

PrayitnodanErmanAnti,1995.Dasar-DasarBimbingan dan Konseling. Jakarta:P2LPTKDepdikbud.

Prayitno, 2003. Panduan Bimbingan danKonseling . Jakarta : DepdikbudDirektorat Pendidikan Dasar dan

Menengah

Seri Pemandu Pelaksanaan Bimbingan danKonselingdiSekolah,2016.PelayananBimbingan dan Konseling di SekolahMenengahPertama.Jakarta:IPBI

Udin S. Winataputra, dkk. 2003. StrategiBelajar Mengajar. Jakarta: PusatPenerbitanUniversitasTerbuka

h�ps://www.halopsikolog.com/17-cara-mengatasi-kesulitan-belajar/119/: 11April2018

W. Gulo. 2005. Strategi Belajar Mengajar.Jakarta:Grasindo.

Winkel,W.S,1991.BimbingandanKonselingdiInstitusi Pendidikan . Jakarta :Gramedia

DISKUSIPANELSEBAGAISARANAMENINGKATKANKEMAMPUANGURUSDNKECAMATANKUNDURUTARAMENYUSUNRENCANAPELAKSANAAN

PEMBELAJARANTEMATIKTAHUN2018

M.Yusuf*

Abstrak:PenelitianinidilaksanakandiSDN003KundurUtara yaknipadaguruSDNKecamatanKundurUtaraKabupatenKarimun. Tujuanpenulisanpenelitian tindakan sekolah ini adalahuntukmengetahuiapakah diskusi panel dapat meningkatkan kemampuan guru untuk menyusun Rencana PelaksanaanPembelajaranTematik.Hasilyangdiperolehdaripenelitianiniadalahbahwadiskusipanel yangdilakukandapat meningkatkan kemampuan guru SDN Kecamatan Kundur Utaramenyusun Rencana PelaksanaanPembelajaranTematik. Ini terbuktidarikenaikannilai yangdiperolehdari awal rata-rata70meningkatmenjadi rata-rata8,56 diSiklus Idanmeningkatmenjadi rata-rata90,68diSiklus II.Kesimpulanyangdiperolehdaripenelitian inibahwadiskusipanel sebagai sarana meningkatkankemampuanguruSDNKecamatanKundurUtaramenyusunRencanaPelaksanaanPembelajaranTematik.

KataKunci:DiskusiPanel,Kemampuanguru,PembelajaranTematik

PENDAHULUAN

Pendidikan akan terus berkembang

sejalan dengan perkembangan zaman dan

menyesuaikan dirimenuju pendidikan yang

mampumenghasilkansumberdayamanusia

yang berkualitas dan memiliki daya saing.

Meningkatkan mutu pendidikan adalah

tanggung jawab semua pihak yang terlibat

dalam pendidikan, terutama guru. Guru

memiliki peranan yang besar dalam

mengemban tugas yang tercantum dalam

PembukaanUndang-UndangDasarRepublik

Indonesia, yaitu mencerdaskan kehidupan

bangsa.

Peneliti sekaligus adalah pengawas

SDN Kecamatan Kundur Utara bermaksud

melakukan penelitian dengan judul “Diskusi

Panel sebagai sarana meningkatkan

kemampuan guru SDN Kecamatan Kundur

Utara menyusun rencana pelaksanaan

pembelajaran tematik”.Penelitimengadakan

diskusi panel dengan guru-guru SDN

KecamatanKundurUtarasebanyak16orang.

Halinisangatperludilaksanakanbagipeneliti

dalamupayamemenuhiharapanpeningkatan

mutupendidikandiKabupatenKarimunpada

khususnyadandiIndonesiapadaumumnya.

Untuk itu guru perlu meningkatkan

mutu pembelajarannya, dimulai dengan

rancangan pembelajaran yang baik dengan

memperhatikan tujuan, karakteristik siswa,

materi yang diajarkan dan sumber belajar

yangtersedia.Salahsatumodelpembelajaran

yang efektif, serta dapat memberikan

kebebasan bagi siswa untuk memanfaatkan

dan mewujudkan potensinya adalah

pembelajarantematik.Pembelajarantematik

lebihmenekankanpadapesertadidikdalam

prosesbelajarmengajarnya.

Pada penelitian ini yang diupayakan

adalah guru-guru dapat menyusun RPP

denganbaik.Ketidakmampuangurumembuat

RencanaPelaksanaan pembelajarantematik

adalahminimnya pengetahuan guru tentang

langkah-langkah pembelajaran tematik

sebagai scenario yang harus dituangkan ke

dalamRPP berdasarkan silabus. Selama ini

guru-guru masih menggunakan copy paste

RPP tematik tanpa pengecekkan kembali

denganpanduansilabus.Guru-gurubiasanya

mengatakan mampu membuat RPP tematik

dengan baik dan selalu mengajar meng-

gunakanRPPtematiktersebut.

Page 67: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

66 67

serta pencapaian prestasi dan karir. Dalam

pemecahanmasalahbelajarsiswadilakukan

denganmentoring oleh guru dan orang tua

siswa.Denganmentoringpemecahanmasalah

siswa oleh guru dan orang tua siswa maka

hasilnyaakankomperhensipdanoptimal.

Saran

Pemecahan masalah belajar siswa

akan lebih efektif jika dilakukan dengan

memperhatikan karakteristik masalah,

siswanya, dan akar budayanya. Pemecahan

masalah tersebut d i lakukan secara

terprogram dan berkelanjutan. Jikamasalah

yang diatasi pada diri siswa juga tidak

mengalami perubahan maka bias juga

menggunakan pihak yang kompeten seperti

psikater.

DAFTAR PUSTAKA

AbinSyamsuddin,2003.PsikologiPendidikan.Bandung:PTRemajaRosdaKarya

E. Mulyasa, 2003. Kurikulum BerbasisKompetensi.Konsep;KarakteristikdanImplementasi. Bandung: P.T. RemajaRosdakarya.

…………...., 2004. Implementasi Kurikulum2004; Panduan Pembelajaran KBK.Bandung:P.T.RemajaRosdakarya.

Kusmoro. 2017, Problematika ImplementasiK13 Tahun 2016. Pontianak: BuletinReviu,LPMPKalbar

PrayitnodanErmanAnti,1995.Dasar-DasarBimbingan dan Konseling. Jakarta:P2LPTKDepdikbud.

Prayitno, 2003. Panduan Bimbingan danKonseling . Jakarta : DepdikbudDirektorat Pendidikan Dasar dan

Menengah

Seri Pemandu Pelaksanaan Bimbingan danKonselingdiSekolah,2016.PelayananBimbingan dan Konseling di SekolahMenengahPertama.Jakarta:IPBI

Udin S. Winataputra, dkk. 2003. StrategiBelajar Mengajar. Jakarta: PusatPenerbitanUniversitasTerbuka

h�ps://www.halopsikolog.com/17-cara-mengatasi-kesulitan-belajar/119/: 11April2018

W. Gulo. 2005. Strategi Belajar Mengajar.Jakarta:Grasindo.

Winkel,W.S,1991.BimbingandanKonselingdiInstitusi Pendidikan . Jakarta :Gramedia

DISKUSIPANELSEBAGAISARANAMENINGKATKANKEMAMPUANGURUSDNKECAMATANKUNDURUTARAMENYUSUNRENCANAPELAKSANAAN

PEMBELAJARANTEMATIKTAHUN2018

M.Yusuf*

Abstrak:PenelitianinidilaksanakandiSDN003KundurUtara yaknipadaguruSDNKecamatanKundurUtaraKabupatenKarimun. Tujuanpenulisanpenelitian tindakan sekolah ini adalahuntukmengetahuiapakah diskusi panel dapat meningkatkan kemampuan guru untuk menyusun Rencana PelaksanaanPembelajaranTematik.Hasilyangdiperolehdaripenelitianiniadalahbahwadiskusipanel yangdilakukandapat meningkatkan kemampuan guru SDN Kecamatan Kundur Utaramenyusun Rencana PelaksanaanPembelajaranTematik. Ini terbuktidarikenaikannilai yangdiperolehdari awal rata-rata70meningkatmenjadi rata-rata8,56 diSiklus Idanmeningkatmenjadi rata-rata90,68diSiklus II.Kesimpulanyangdiperolehdaripenelitian inibahwadiskusipanel sebagai sarana meningkatkankemampuanguruSDNKecamatanKundurUtaramenyusunRencanaPelaksanaanPembelajaranTematik.

KataKunci:DiskusiPanel,Kemampuanguru,PembelajaranTematik

PENDAHULUAN

Pendidikan akan terus berkembang

sejalan dengan perkembangan zaman dan

menyesuaikan dirimenuju pendidikan yang

mampumenghasilkansumberdayamanusia

yang berkualitas dan memiliki daya saing.

Meningkatkan mutu pendidikan adalah

tanggung jawab semua pihak yang terlibat

dalam pendidikan, terutama guru. Guru

memiliki peranan yang besar dalam

mengemban tugas yang tercantum dalam

PembukaanUndang-UndangDasarRepublik

Indonesia, yaitu mencerdaskan kehidupan

bangsa.

Peneliti sekaligus adalah pengawas

SDN Kecamatan Kundur Utara bermaksud

melakukan penelitian dengan judul “Diskusi

Panel sebagai sarana meningkatkan

kemampuan guru SDN Kecamatan Kundur

Utara menyusun rencana pelaksanaan

pembelajaran tematik”.Penelitimengadakan

diskusi panel dengan guru-guru SDN

KecamatanKundurUtarasebanyak16orang.

Halinisangatperludilaksanakanbagipeneliti

dalamupayamemenuhiharapanpeningkatan

mutupendidikandiKabupatenKarimunpada

khususnyadandiIndonesiapadaumumnya.

Untuk itu guru perlu meningkatkan

mutu pembelajarannya, dimulai dengan

rancangan pembelajaran yang baik dengan

memperhatikan tujuan, karakteristik siswa,

materi yang diajarkan dan sumber belajar

yangtersedia.Salahsatumodelpembelajaran

yang efektif, serta dapat memberikan

kebebasan bagi siswa untuk memanfaatkan

dan mewujudkan potensinya adalah

pembelajarantematik.Pembelajarantematik

lebihmenekankanpadapesertadidikdalam

prosesbelajarmengajarnya.

Pada penelitian ini yang diupayakan

adalah guru-guru dapat menyusun RPP

denganbaik.Ketidakmampuangurumembuat

RencanaPelaksanaan pembelajarantematik

adalahminimnya pengetahuan guru tentang

langkah-langkah pembelajaran tematik

sebagai scenario yang harus dituangkan ke

dalamRPP berdasarkan silabus. Selama ini

guru-guru masih menggunakan copy paste

RPP tematik tanpa pengecekkan kembali

denganpanduansilabus.Guru-gurubiasanya

mengatakan mampu membuat RPP tematik

dengan baik dan selalu mengajar meng-

gunakanRPPtematiktersebut.

Page 68: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

68 69

Adanya diskusi panel yang peneliti

lakukan tidak lain agar dapat menciptakan

kembaliataumerubahtingkahlakuguru,guru

perludiberikanilmutentanglangkah-langkah

pembelajaran tematik dengan baik yakni

menggunakan silabus sebagai acuan bukan

hanyacukupdengancopypastesaja.

Rumusan masalah dalam penelitian

ini adalah: apakah diskusi panel sebagai

sarana meningkatkankemampuanguruSDN

KecamatanKundurUtaramenyusunrencana

pelaksanaan pembelajaran (RPP) tematik.

Tujuan Penelitian, Penelitian ini bertujuan

untukmengetahui seberapa tinggi kenaikan

kemampuan guru SDN Kecamatan Kundur

Utara menyusun rencana pelaksanaan

pembelajaran tematikmelaluidiskusipanel.

Manfaat Penelitian, Hasil penelitian ini

diharapkandapatmemberimanfaat:1)Bagi

guru diharapkan sebagai re�leksi diri,

selanjutnya diadakan perbaikan dan

peningkatandalamrangkamencapaiprestasi

belajar yang didasarkan kepada teori

pembelajarantematik;2)Bagikepalasekolah

sebagaiumpanbalikbagiperbaikankualitas

rencana pelaksanaan pembelajaran dan

terjadinya peningkatan kualitas proses

pembelajaran; 3) Bagi pengawas sebagai

bahaninformasitentangkondisiriilyangada

dilapangan dalam upaya peningkatan

profesionalisme guru; 4) Bagi Kepala Dinas

Pendidikan merupakan informasi penting

dalam melaksanakan pembinaan dan

tindakan-tindakan lainnya untuk me-

ningkatkankemampuanguru-gurudiwilayah

kerjanya.

KAJIAN TEORI

Pembelajaran Tematik

Undang-undang Sistem Pendidikan

NasionalNomor20tahun2003menyatakan

bahwapembelajaranadalahproses interaksi

peserta didik dengan pendidik dan sumber

belajar pada suatu lingkungan belajar.

SedangkanmenurutSyaifulSagala(2006:61)

pembelajaran adalah membelajarkan siswa

menggunakanasaspendidikanmaupunteori

belajar yang merupakan penentu utama

keberhasilanpendidikan

Pendapat Daryanto (2014:5) pem-

belajaran tematik dapat memberikan

pengalaman langsung (direct experiences).

Pengalaman langsung adalah peserta didik

dihadapkanpadasesuatuhanyaberdasarkan

dari keterangan guru atau buku-buku

pelajaran.

Adapunruanglingkuppengembangan

pembelajarantematikmeliputiseluruhmata

pelajaranpadakelasIsampaidengankelasVI

sekolah dasar, yaitu pada mata pelajaran

Pendidikan Agama, Bahasa Indonesia,

Matematika, Ilmu Pengetahuan Alam, Pen-

didikanKewarganegaraan,IlmuPengetahuan

Sosial, Seni Budaya dan Keterampilan, serta

PendidikanJasmani,OlahragadanKesehatan

(Kunandar,2011:340).

RencanaPelaksanaanPembelajaran(RPP)

yang mengikut i l angkah- langkah

pembelajarantematik

RPP yang baik adalah memuat

aktivitas proses belajarmengajar yang akan

dilaksanakan oleh guru, dan menjadi

pengalaman belajar bagi siswa.Guru

berkewajibanmenyusunRPPsecara lengkap

dan sistimatis agar pembelajaran mem-

berikan ruang yang cukup bagi prakarsa,

kreativitasdankemandiriansiswa.

Sebagaisuatumodelpembelajarandi

sekolahdasar,menurutKunandar(2011:341-

342) pembelajaran tematik memiliki

karakteristik sebagai berikut: a) Berpusat

pada siswa. Pembelajaran tematik berpusat

pada siswa (student centered), hal ini sesuai

dengan pendekatan belajar modern yang

lebih banyak menempatkan siswa sebagai

subjekbelajar sedangkanguru lebihbanyak

berperan sebagai fasilitator yaitu mem-

berikan kemudahan-kemudahan kepada

siswa dalam kaitannya dengan aktivitas

belajar; b) Memberikan pengalaman

langsung, Pembelajaran tematik dapat

memberikan pengalaman langsung kepada

siswa (direct experiences). Dengan pe-

ngalaman langsung ini, siswa dihadapkan

pada sesuatu yang konkrit sebagai dasar

untukmemahamihal-halyanglebihabstrak,

sehinggakonsep-konsepyangdiperolehakan

semakin kuat dan lebihmudah diingat oleh

siswa, c) Pemisahan mata pelajaran tidak

begitu jelas. Dalam pembelajaran tematik

pemisahan antar mata pelajaran menjadi

tidak begitu jelas. Fokus pembelajaran

diarahkan kepada pembahasan tema-tema

yang berkaitan dengan kehidupan siswa; d)

Menyajikan konsep dari berbagai mata-

pelajaran; e) Pembelajaran tematik me-

nyajikan konsep-konsep dari berbagai mata

pelajarandalamsuatuprosespembelajaran.

Dengandemikian,Siswamampumemahami

konsep-konsep tersebut secarautuh.Hal ini

diperlukan untuk membantu siswa dalam

memecahkanmasalah-masalahyangdihadapi

dalam kehidupan sehari-hari; f) Bersifat

�leksibel.Pembelajarantematikbersifatluwes

(�leksibel) dimana guru dapat mengaitkan

bahan ajar dari satumata pelajaran dengan

mata pelajaran yang lainnya, bahkan

mengaitkannyadengankehidupansiswadan

keadaan lingkungan dimana sekolah dan

siswa berada; g) Hasil pembelajaran sesuai

dengan minat dan kebutuhan siswa. Siswa

diberi kesempatan untuk mengoptimalkan

potensiyangdimilikinyasesuaidenganminat

dankebutuhannya;h)Menggunakanprinsip

belajar sambil bermain danmenyenangkan.

Kegiatan pembelajaran di kelas dapat

dilaksanakan dengan berbagai metode

sehingga akan tercipta kegiatan yang

menyenangkanbagisiswa.

Adapun langkah-langkah pem-

belajaran tematik meliputi tiga tahap yaitu

tahap perencanaan, tahap pelaksanaan, dan

tahap evaluasi. Langkah-langkah pem-

belajaran tematikdiuraikansebagaiberikut:

a)Tahapperencanaan:1)Menentukan jenis

mata pelajaran dan jenis keterampilan yang

dipadukan;2)Memilihdanmenetapkantema

pemersatu;3)Memilihkajianmateri,standar

kompetensi,kompetensidasar,danindikator;

4) Membuat matriks atau bagan hubungan

kompetensidasardantema/topikpemersatu;

5)Menyusun silabus pembelajaran tematik;

6) Penyusunan rencana pembelajaran

tematik; 7) Merumuskan indicator hasil

belajar; 8) Menentukan langkah-langkah

pembelajaran. b) Tahap Pelaksana. dalam

melaksanakan pembelajaran tematik di

sekolahdasar,guruperlumenguasaiberbagai

macamkegiatanyangmenarik.Dimulaidari

kegiatanmembukapelajaran,menjelaskanisi

tema, mengajukan pertanyaan-pertanyaan,

memberikanpenguatan,mengadakanvariasi

mengajar,sampaidenganmenutuppelajaran,

c) Tahap Evaluasi. Penilaian pencapaian

kompetensi dasar peserta didik dilakukan

berdasarkan indikator. Penilaian dilakukan

denganmenggunakan tesdannontesdalam

bentuk tertulis maupun lisan, penilaian

pengamatan, penilaian kinerja, pengukuran

sikap,penilaianhasilkaryaberupatugas,pro-

yekdan/atauproduk,penggunaanportofolio

danpenilaiandiri(Trianto,2011:168).

Page 69: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

68 69

Adanya diskusi panel yang peneliti

lakukan tidak lain agar dapat menciptakan

kembaliataumerubahtingkahlakuguru,guru

perludiberikanilmutentanglangkah-langkah

pembelajaran tematik dengan baik yakni

menggunakan silabus sebagai acuan bukan

hanyacukupdengancopypastesaja.

Rumusan masalah dalam penelitian

ini adalah: apakah diskusi panel sebagai

sarana meningkatkankemampuanguruSDN

KecamatanKundurUtaramenyusunrencana

pelaksanaan pembelajaran (RPP) tematik.

Tujuan Penelitian, Penelitian ini bertujuan

untukmengetahui seberapa tinggi kenaikan

kemampuan guru SDN Kecamatan Kundur

Utara menyusun rencana pelaksanaan

pembelajaran tematikmelaluidiskusipanel.

Manfaat Penelitian, Hasil penelitian ini

diharapkandapatmemberimanfaat:1)Bagi

guru diharapkan sebagai re�leksi diri,

selanjutnya diadakan perbaikan dan

peningkatandalamrangkamencapaiprestasi

belajar yang didasarkan kepada teori

pembelajarantematik;2)Bagikepalasekolah

sebagaiumpanbalikbagiperbaikankualitas

rencana pelaksanaan pembelajaran dan

terjadinya peningkatan kualitas proses

pembelajaran; 3) Bagi pengawas sebagai

bahaninformasitentangkondisiriilyangada

dilapangan dalam upaya peningkatan

profesionalisme guru; 4) Bagi Kepala Dinas

Pendidikan merupakan informasi penting

dalam melaksanakan pembinaan dan

tindakan-tindakan lainnya untuk me-

ningkatkankemampuanguru-gurudiwilayah

kerjanya.

KAJIAN TEORI

Pembelajaran Tematik

Undang-undang Sistem Pendidikan

NasionalNomor20tahun2003menyatakan

bahwapembelajaranadalahproses interaksi

peserta didik dengan pendidik dan sumber

belajar pada suatu lingkungan belajar.

SedangkanmenurutSyaifulSagala(2006:61)

pembelajaran adalah membelajarkan siswa

menggunakanasaspendidikanmaupunteori

belajar yang merupakan penentu utama

keberhasilanpendidikan

Pendapat Daryanto (2014:5) pem-

belajaran tematik dapat memberikan

pengalaman langsung (direct experiences).

Pengalaman langsung adalah peserta didik

dihadapkanpadasesuatuhanyaberdasarkan

dari keterangan guru atau buku-buku

pelajaran.

Adapunruanglingkuppengembangan

pembelajarantematikmeliputiseluruhmata

pelajaranpadakelasIsampaidengankelasVI

sekolah dasar, yaitu pada mata pelajaran

Pendidikan Agama, Bahasa Indonesia,

Matematika, Ilmu Pengetahuan Alam, Pen-

didikanKewarganegaraan,IlmuPengetahuan

Sosial, Seni Budaya dan Keterampilan, serta

PendidikanJasmani,OlahragadanKesehatan

(Kunandar,2011:340).

RencanaPelaksanaanPembelajaran(RPP)

yang mengikut i l angkah- langkah

pembelajarantematik

RPP yang baik adalah memuat

aktivitas proses belajarmengajar yang akan

dilaksanakan oleh guru, dan menjadi

pengalaman belajar bagi siswa.Guru

berkewajibanmenyusunRPPsecara lengkap

dan sistimatis agar pembelajaran mem-

berikan ruang yang cukup bagi prakarsa,

kreativitasdankemandiriansiswa.

Sebagaisuatumodelpembelajarandi

sekolahdasar,menurutKunandar(2011:341-

342) pembelajaran tematik memiliki

karakteristik sebagai berikut: a) Berpusat

pada siswa. Pembelajaran tematik berpusat

pada siswa (student centered), hal ini sesuai

dengan pendekatan belajar modern yang

lebih banyak menempatkan siswa sebagai

subjekbelajar sedangkanguru lebihbanyak

berperan sebagai fasilitator yaitu mem-

berikan kemudahan-kemudahan kepada

siswa dalam kaitannya dengan aktivitas

belajar; b) Memberikan pengalaman

langsung, Pembelajaran tematik dapat

memberikan pengalaman langsung kepada

siswa (direct experiences). Dengan pe-

ngalaman langsung ini, siswa dihadapkan

pada sesuatu yang konkrit sebagai dasar

untukmemahamihal-halyanglebihabstrak,

sehinggakonsep-konsepyangdiperolehakan

semakin kuat dan lebihmudah diingat oleh

siswa, c) Pemisahan mata pelajaran tidak

begitu jelas. Dalam pembelajaran tematik

pemisahan antar mata pelajaran menjadi

tidak begitu jelas. Fokus pembelajaran

diarahkan kepada pembahasan tema-tema

yang berkaitan dengan kehidupan siswa; d)

Menyajikan konsep dari berbagai mata-

pelajaran; e) Pembelajaran tematik me-

nyajikan konsep-konsep dari berbagai mata

pelajarandalamsuatuprosespembelajaran.

Dengandemikian,Siswamampumemahami

konsep-konsep tersebut secarautuh.Hal ini

diperlukan untuk membantu siswa dalam

memecahkanmasalah-masalahyangdihadapi

dalam kehidupan sehari-hari; f) Bersifat

�leksibel.Pembelajarantematikbersifatluwes

(�leksibel) dimana guru dapat mengaitkan

bahan ajar dari satumata pelajaran dengan

mata pelajaran yang lainnya, bahkan

mengaitkannyadengankehidupansiswadan

keadaan lingkungan dimana sekolah dan

siswa berada; g) Hasil pembelajaran sesuai

dengan minat dan kebutuhan siswa. Siswa

diberi kesempatan untuk mengoptimalkan

potensiyangdimilikinyasesuaidenganminat

dankebutuhannya;h)Menggunakanprinsip

belajar sambil bermain danmenyenangkan.

Kegiatan pembelajaran di kelas dapat

dilaksanakan dengan berbagai metode

sehingga akan tercipta kegiatan yang

menyenangkanbagisiswa.

Adapun langkah-langkah pem-

belajaran tematik meliputi tiga tahap yaitu

tahap perencanaan, tahap pelaksanaan, dan

tahap evaluasi. Langkah-langkah pem-

belajaran tematikdiuraikansebagaiberikut:

a)Tahapperencanaan:1)Menentukan jenis

mata pelajaran dan jenis keterampilan yang

dipadukan;2)Memilihdanmenetapkantema

pemersatu;3)Memilihkajianmateri,standar

kompetensi,kompetensidasar,danindikator;

4) Membuat matriks atau bagan hubungan

kompetensidasardantema/topikpemersatu;

5)Menyusun silabus pembelajaran tematik;

6) Penyusunan rencana pembelajaran

tematik; 7) Merumuskan indicator hasil

belajar; 8) Menentukan langkah-langkah

pembelajaran. b) Tahap Pelaksana. dalam

melaksanakan pembelajaran tematik di

sekolahdasar,guruperlumenguasaiberbagai

macamkegiatanyangmenarik.Dimulaidari

kegiatanmembukapelajaran,menjelaskanisi

tema, mengajukan pertanyaan-pertanyaan,

memberikanpenguatan,mengadakanvariasi

mengajar,sampaidenganmenutuppelajaran,

c) Tahap Evaluasi. Penilaian pencapaian

kompetensi dasar peserta didik dilakukan

berdasarkan indikator. Penilaian dilakukan

denganmenggunakan tesdannontesdalam

bentuk tertulis maupun lisan, penilaian

pengamatan, penilaian kinerja, pengukuran

sikap,penilaianhasilkaryaberupatugas,pro-

yekdan/atauproduk,penggunaanportofolio

danpenilaiandiri(Trianto,2011:168).

Page 70: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

70 71

DiskusiPanel

Kata“Panel”berasaldaribahasalatin

yaitu panelis yang berarti sejumlah orang

yang ditunjuk menyelenggarakan tugas

tertentu (Ramayulis, 2005:261). Sedangkan

diskusimenurutMulyasa(2007:116)diskusi

dapatdiartikansebagaipercakapanresponsif

yang dijalin oleh pertanyaan-pertanyaan

problematis yang diarahkan untuk mem-

perolehpemecahanmasalah.

Berdasarkan pendapat diatas, dapat

diambil kesimpulan bahwa dari sebuah

diskusi panel akan memperoleh informasi

yang dapat memperkaya pengetahuan

tentang suatu masalah atau topik dari

beberapatitikpandangyangberbeda.Pokok-

pokok pembicaraan merupakan bagian

penting yang dapat diuraikan dalam suatu

pembicaraan.Bagianpentingitubisaberupa

gagasanataupokokpermasalahan.

Menurut Buchari Alma (2008:67)

bahwa ada beberapa langkah-langkah yang

harus ditempuh dalam pelaksanaan diskusi

panel: a) Persiapan: 1) Memilih beberapa

orangyangdianggapmenguasaimasalahyang

akan dipanelkan, 2) Menyiapkan ruangan

untuktempatdudukpesertasehinggadiskusi

dapat berjalan dengan baik, 3) Memimpin

jalannya diskusi panel dan menggarahkan

kepada bahan yang dipanelkan serta dapat

mengambil kesimpulan tertentu, 4) Me-

rencanakan waktu yang terpakai selama

diskusi panel; b) Pelaksanaan: 1) Menge-

mukakan bahan yang akan dipanelkan, 2)

Memperkenalkan panelis , 2) Semua

pendapat-pendapat didiskusikan, 3) Me-

ngemukakan kesimpulan-kesimpulan, 4)

Panelditutup.

Diharapkan diskusi panel dapat

berjalan lancar dan menemui sasarannya,

maka harus dipersiapkan kondisi-kondisi

yangmemadaidariparapesertasebagaisuatu

keseluruhan, antara lain: 1) Satu sama lain

haruskenalmengenal,2)Parapesertaharus

sudahmenyiapkandiri,3)Pesertaberusaha

ber�ikirdenganbijakmengenaimasalah,dan

harus menilai pembicaraannya dari kaca

mata,ide-idedanfaktabaruyangberkembang

dalam diskusi, 4) Para peserta harus sabar

dan menarik, 5) Para peserta diskusi panel

harus mengembangkan rasa kebersamaan

kelompok,6)Diskusipanelharusberpegang

pada pokok masalah, hendaknya mereka

merasabebasuntukbertanyaataumendapat

penjelasan satu dengan yang lainmengenai

halyangkurangjelasdaripembicaraanyang

sedang berlangsung, sehingga setiap

perbincanganmenjadi jelas, 7)Parapeserta

diskusipaneldapatsalingmembantu.Mereka

hendaknya mendorong atau meminta

pendapatdariteman-temannya.Jikaperluia

berusaha menolong dengan menerangkan

kembaliapayangsudahdibicarakannyatadi.

Ia dapat meminta orang lain untuk

menyatakangagasan-gagasannya.Disamping

itu pun dapat pula menilai dirinya sendiri

mengenai hal-hal yang sudah dibicarakan

atau mengenai sikap dan seberapa jauh

sumbangannya terhadap diskusi yang

ikutinyaitu.

Adapun dalam penelitian ini adalah

mengupayakan agar penyusunan RPP bisa

dilakukandenganbenarsesuaidiskusipanel

yaknimemasukkanlangkah-langkahyangada

dalam pembelajaran tematik. Tujuannya

adalahuntukpemberdayaandanpartisipasi

dari hasil yang dicapai disampaikan secara

terbuka.

Kompetensi/Kemampuan

Pengertian dasar kompetensi yakni

kemampuan atau kecakapan. Kompetensi

berarti suatu hal yang menggambarkan

kualitas atau kemampuan seseorang baik

yang kualitatif maupun yang kuantitatif

(Usman, 1994:1). Sedangkan menurut

Sudjana (2009:15) mengemukakan bahwa

adatigatugasdantanggungjawabguru,yakni

guru sebagai pengajar, guru sebagai

pembimbing,dangurusebagaiadministrator

kelas. Karena guru juga merupakan barisan

pengembangkurikulumyangterdepanmaka

gurupelaku yang selalumelakukan evaluasi

dan penyempurnaan terhadap kurikulum.

Menyadari hal tersebut, betapa pentingnya

untukmeningkatkan kemampuan guru baik

pada aktivitas, kreativitas, kualitas, dan

profesionalguru.

Kesimpulan de�inisi operasional

penelitian ini berdasarkan teori-teori

kemampuan/kompetensiguruadalahtentang

menyusun rencana pelaksanaan pem-

belajaran merupakan kegiatan yang

dilakukan guru dengan berdiskusi yakni

diskusi panel untuk dapat menyelesaikan

suatu pekerjaan yang ditugasinya yaitu

menyusun RPP tematik sesuai dengan

kurikulumyangberlaku.Dalamhal ini,yang

inginpenelitiupayakanadalahmelaluidiskusi

panel sebagai sarana meningkatkan ke-

mampuan guru menyusun rencana pe-

laksanaanpembelajarantematik.

METODOLOGIPENELITIAN

Rancangan Penelitian

Untukpenelitian inipenulismemilih

rancangan penelitian tindakan yang di-

sampaikan oleh Suharsimi Arikunto,

Suhardjono, Supardi (2006:74) seperti

terlihatpadagambarberikut:

Gambar1.RancanganPenelitian

Permasalahan Perencanaan

Tindakan I

Pelaksanaan

Tindakan I

Refleksi I

Pengamatan/p

engumpulan

data

Perencanaan

Tindakan II

Pelaksanaan

Tindakan II

Refleksi II

Pengamatan/pe

ngumpulan data

II

Permasalahan baru

hasil refleksi

Apabila permasalahan

belum terselesaikan

Dilanjutkan ke siklus

selanjutnya

Siklus I

Siklus II

SubjekdanObjekPenelitian

Subjekdaripenelitianiniadalahguru-

guruSekolahDasarNegeriKecamatanKundur

Utarasebanyak16orang.Objekpenelitianini

adalah peningkatan kemampuan guru

menyusun Rencana Pelaksanaan Pem-

belajaranTematikmelaluidiskusipanel.

WaktuPenelitian

Penelitian ini dilakukan pada se-

mester1(satu)tahunpelajaran2018/2019.

Penelitiandilaksanakanselama4bulanyaitu

bulanJuli2018sampaidenganOktober2018.

MetodePengumpulanData

Metode secara umum diartikan se-

bagai proses, cara, atau prosedur yang

digunakan untuk memecahkan suatu

masalah.Metodeyangdigunakanuntukme-

ngumpulkandatadalampenelitianiniadalah

StudiPustaka.

MetodeAnalisisData

Metode penelitian deskriptif yaitu

metode yang membicarakan beberapa ke-

mungkinan untuk memecahkan masalah

aktual dengan jalan mengumpulkan data,

menyusun atau mengklasi�ikasinya, men-

ganalisis,danmenginterprestasikannya.

Metode yang digunakan untuk me-

Page 71: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

70 71

DiskusiPanel

Kata“Panel”berasaldaribahasalatin

yaitu panelis yang berarti sejumlah orang

yang ditunjuk menyelenggarakan tugas

tertentu (Ramayulis, 2005:261). Sedangkan

diskusimenurutMulyasa(2007:116)diskusi

dapatdiartikansebagaipercakapanresponsif

yang dijalin oleh pertanyaan-pertanyaan

problematis yang diarahkan untuk mem-

perolehpemecahanmasalah.

Berdasarkan pendapat diatas, dapat

diambil kesimpulan bahwa dari sebuah

diskusi panel akan memperoleh informasi

yang dapat memperkaya pengetahuan

tentang suatu masalah atau topik dari

beberapatitikpandangyangberbeda.Pokok-

pokok pembicaraan merupakan bagian

penting yang dapat diuraikan dalam suatu

pembicaraan.Bagianpentingitubisaberupa

gagasanataupokokpermasalahan.

Menurut Buchari Alma (2008:67)

bahwa ada beberapa langkah-langkah yang

harus ditempuh dalam pelaksanaan diskusi

panel: a) Persiapan: 1) Memilih beberapa

orangyangdianggapmenguasaimasalahyang

akan dipanelkan, 2) Menyiapkan ruangan

untuktempatdudukpesertasehinggadiskusi

dapat berjalan dengan baik, 3) Memimpin

jalannya diskusi panel dan menggarahkan

kepada bahan yang dipanelkan serta dapat

mengambil kesimpulan tertentu, 4) Me-

rencanakan waktu yang terpakai selama

diskusi panel; b) Pelaksanaan: 1) Menge-

mukakan bahan yang akan dipanelkan, 2)

Memperkenalkan panelis , 2) Semua

pendapat-pendapat didiskusikan, 3) Me-

ngemukakan kesimpulan-kesimpulan, 4)

Panelditutup.

Diharapkan diskusi panel dapat

berjalan lancar dan menemui sasarannya,

maka harus dipersiapkan kondisi-kondisi

yangmemadaidariparapesertasebagaisuatu

keseluruhan, antara lain: 1) Satu sama lain

haruskenalmengenal,2)Parapesertaharus

sudahmenyiapkandiri,3)Pesertaberusaha

ber�ikirdenganbijakmengenaimasalah,dan

harus menilai pembicaraannya dari kaca

mata,ide-idedanfaktabaruyangberkembang

dalam diskusi, 4) Para peserta harus sabar

dan menarik, 5) Para peserta diskusi panel

harus mengembangkan rasa kebersamaan

kelompok,6)Diskusipanelharusberpegang

pada pokok masalah, hendaknya mereka

merasabebasuntukbertanyaataumendapat

penjelasan satu dengan yang lainmengenai

halyangkurangjelasdaripembicaraanyang

sedang berlangsung, sehingga setiap

perbincanganmenjadi jelas, 7)Parapeserta

diskusipaneldapatsalingmembantu.Mereka

hendaknya mendorong atau meminta

pendapatdariteman-temannya.Jikaperluia

berusaha menolong dengan menerangkan

kembaliapayangsudahdibicarakannyatadi.

Ia dapat meminta orang lain untuk

menyatakangagasan-gagasannya.Disamping

itu pun dapat pula menilai dirinya sendiri

mengenai hal-hal yang sudah dibicarakan

atau mengenai sikap dan seberapa jauh

sumbangannya terhadap diskusi yang

ikutinyaitu.

Adapun dalam penelitian ini adalah

mengupayakan agar penyusunan RPP bisa

dilakukandenganbenarsesuaidiskusipanel

yaknimemasukkanlangkah-langkahyangada

dalam pembelajaran tematik. Tujuannya

adalahuntukpemberdayaandanpartisipasi

dari hasil yang dicapai disampaikan secara

terbuka.

Kompetensi/Kemampuan

Pengertian dasar kompetensi yakni

kemampuan atau kecakapan. Kompetensi

berarti suatu hal yang menggambarkan

kualitas atau kemampuan seseorang baik

yang kualitatif maupun yang kuantitatif

(Usman, 1994:1). Sedangkan menurut

Sudjana (2009:15) mengemukakan bahwa

adatigatugasdantanggungjawabguru,yakni

guru sebagai pengajar, guru sebagai

pembimbing,dangurusebagaiadministrator

kelas. Karena guru juga merupakan barisan

pengembangkurikulumyangterdepanmaka

gurupelaku yang selalumelakukan evaluasi

dan penyempurnaan terhadap kurikulum.

Menyadari hal tersebut, betapa pentingnya

untukmeningkatkan kemampuan guru baik

pada aktivitas, kreativitas, kualitas, dan

profesionalguru.

Kesimpulan de�inisi operasional

penelitian ini berdasarkan teori-teori

kemampuan/kompetensiguruadalahtentang

menyusun rencana pelaksanaan pem-

belajaran merupakan kegiatan yang

dilakukan guru dengan berdiskusi yakni

diskusi panel untuk dapat menyelesaikan

suatu pekerjaan yang ditugasinya yaitu

menyusun RPP tematik sesuai dengan

kurikulumyangberlaku.Dalamhal ini,yang

inginpenelitiupayakanadalahmelaluidiskusi

panel sebagai sarana meningkatkan ke-

mampuan guru menyusun rencana pe-

laksanaanpembelajarantematik.

METODOLOGIPENELITIAN

Rancangan Penelitian

Untukpenelitian inipenulismemilih

rancangan penelitian tindakan yang di-

sampaikan oleh Suharsimi Arikunto,

Suhardjono, Supardi (2006:74) seperti

terlihatpadagambarberikut:

Gambar1.RancanganPenelitian

Permasalahan Perencanaan

Tindakan I

Pelaksanaan

Tindakan I

Refleksi I

Pengamatan/p

engumpulan

data

Perencanaan

Tindakan II

Pelaksanaan

Tindakan II

Refleksi II

Pengamatan/pe

ngumpulan data

II

Permasalahan baru

hasil refleksi

Apabila permasalahan

belum terselesaikan

Dilanjutkan ke siklus

selanjutnya

Siklus I

Siklus II

SubjekdanObjekPenelitian

Subjekdaripenelitianiniadalahguru-

guruSekolahDasarNegeriKecamatanKundur

Utarasebanyak16orang.Objekpenelitianini

adalah peningkatan kemampuan guru

menyusun Rencana Pelaksanaan Pem-

belajaranTematikmelaluidiskusipanel.

WaktuPenelitian

Penelitian ini dilakukan pada se-

mester1(satu)tahunpelajaran2018/2019.

Penelitiandilaksanakanselama4bulanyaitu

bulanJuli2018sampaidenganOktober2018.

MetodePengumpulanData

Metode secara umum diartikan se-

bagai proses, cara, atau prosedur yang

digunakan untuk memecahkan suatu

masalah.Metodeyangdigunakanuntukme-

ngumpulkandatadalampenelitianiniadalah

StudiPustaka.

MetodeAnalisisData

Metode penelitian deskriptif yaitu

metode yang membicarakan beberapa ke-

mungkinan untuk memecahkan masalah

aktual dengan jalan mengumpulkan data,

menyusun atau mengklasi�ikasinya, men-

ganalisis,danmenginterprestasikannya.

Metode yang digunakan untuk me-

Page 72: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

72 73

nganalisis data hasil penelitian ini adalah

metodedeskriptifkuantitatif.

Kisi-kisiInstrumenPenelitian

Kisi-kisi sangatpentingdibuatuntuk

memberi arah terhadap hal-hal yang di-

pertanyakan dalam instrumen penelitian.

Tujuan penyusunan kisi-kisi instrumen

adalahmerencanakansetepatmungkinruang

l ingkup dan tekanan tes dan bagian-

bagiannya, sehingga perumusan tersebut

dapat menjadi petunjuk ysng efektif bagi

penyusunan tes, terlebih-lebih bagi penulis

soal(Suryabrata,2000:60-61).

Indikator Kinerja/Kriteria Keberhasilan

Penelitian

Dalampenelitian ini diusulkan tingkat

keberhasilan per siklus yaitu siklus I di-

usulkan kemampuan guru menyusun RPP

mencapainilairata-rataBdenganskor71–85

danpadasiklusIIdiusulkankemampuanguru

sudah mencapai nilai rata-rata A (sangat

sempurna)denganskor86–100.

Kriteria:

A=sangatsempurna(skor86–100)

B=sempurna(skor71–85)

C=kurangsempurna(skor51–70)

D=tidaksempurna(skordibawah50)

HASILPENELITIANDANPEMBAHASAN

Adapun dilihat dari data awal guru

dalam menyusun Rencana Pelaksanaan

Pembelajaran (RPP) cukup rendah yaitu

masih mencapai nilai rata-rata 43,75% (7

orang)guru,dibawahnilai rata-rata31,25%

(5orang)guru,dandiatasnilairata-rata25%

(4orang)gurudenganskorrata-rata70yakni

nilaikualitatifrata-rataC(kurangsempurna),

maka perencanaan awal yang dilakukan

adalahmenyiapkan langkah-langkah diskusi

panel sebagai sarana meningkatkan ke-

mampuangurumenyusunRPPTematikSDN

KecamatanKundurUtara.

Untuk ini dilakukan dengan me-

nyiapkan ruangan diskusi panel dan me-

nggarahkan kepada bahan yang akan di-

diskusikansertawaktuyangtelahditentukan

dengan cara guru sekolah dasar negeri

kecamatanKundurUtaradikumpulkandiSDN

003KecamatanKundurUtara.

Persiapanyang sudah cukupmatang

dalam perencanaan ini adalah menyiapkan

jadwaldiskusipaneldanblankoRPPTematik

yang sudah diisi judul-judul yang mesti

dilakukan pada saat menulis RPP Tematik,

agarguru-gurudapatmelaksanakandengan

baikdanterarah.

Has i l yang d ipero leh dar i pe-

rencanaan adalah tercapainya kesepakatan

pertemuan diskusi panel dengan guru-guru

dan terselesainya blanko RPP perbaikan

dalam menyusun RPP Tematik yang me-

rupakan perbaikan-perbaikan perencanaan

pembelajarandanterlaksananyaarahanserta

bimbingan yang telah diberikan untuk hasil

rencana pelaksanaan pembelajaran tematik

yangberkualitas.

Pelaksanaanpenelitian Siklus I yaitu

mengumpulkanguruSDNKecamatanKundur

UtaradiSDN003KundurUtara yangsudah

disepakatimengingatguru-guruyangditeliti

berasal dari beberapa sekolah. Pelaksanaan

dimulai dengan menjelaskan pembelajaran

tematik, diteruskan dengan penyebaran

blanko RPP yang merupakan blanko per-

baikan cara-cara pembelajaran yangpenulis

kembangkan sendiri sebagaibentuk inovasi.

SetelahblankoRPPdibagikansebagaibahan

yang akan didiskusikan, dilanjutkan dengan

pendapat-pendapat guru-guru serta dapat

mengemukakan kesimpulan-kesimpulan

sehinggadiskusipaneldapatditutupdengan

baikdanlancar.

Penelitian ini, observasi atau pe-

ngamatan tertuju pada hal-hal seperti:

kebenaran penulisan indikator, kebenaran

menulis tujuan pembelajaran, konstruksi

yang dilakukan terhadap blanko RPP yang

diberikan serta kontribusi yang dapat

diberikan.Hal-hal tersebutmemangdiamati

oleh peneliti, namun yang menjadi acuan

akhiradalahkebenaranisiRPPtematikyang

dibuat karena tujuan penelitian ini adalah

untukmengetahui peningkatan kemampuan

guru-gurumenyusunRPPtematik.

AnalisisdanRe�leksiSiklus Idiambil

dari data hasil penelitian kemampuan guru

menyusun RPP yang mengikuti dengan

memasukkan unsur-unsur yang dituntut

dalampembelajarantematik.

Data memperlihatkan bahwa 37,5%

guru memperoleh skor rata-rata (6 orang),

sebanyak 31,25% guru memperoleh skor

dibawah rata-rata (5 orang), dan sebanyak

31,25% guru memperoleh skor diatas rata-

rata (5 orang). Sehingga dalam penyusunan

RPPtematikdari16oranggurudengannilai

rata-rata 80,56 (delapan puluh koma lima

puluh enam) klasi�ikasi B, masih perlu

diadakan diskusi panel untuk penyusunan

RPPtematikpadasiklusselanjutnya.

PadaSiklusIIinipenelitimelanjutkan

penelitian mulai dari perencanaan sampai

dengan analisis dan re�leksi Siklus II yakni

hasilyangdisampaikanpadasiklusIIadalah

terhadapRPPyangdisampaikangurusetelah

semuanya dilaksanakan dalam upaya per-

baikan.

Adapunhasilmemperlihatkanbahwa

43,75% guru memperoleh skor rata-rata (7

orang), sebanyak 31,25% gurumemperoleh

skor dibawah rata-rata (5 orang), dan

sebanyak 25%gurumemperolehskordiatas

rata-rata (4 orang). Sehingga dalam pe-

nyusunan RPP dari 16 orang guru dengan

nilai rata-rata 90,68 (Sembilan puluh koma

enam delapan) klasi�ikasi A. Nilai ini sudah

memenuhi kriteria usulan penilaian pada

Siklus IIyaituminimal86-100.Supaya lebih

jelasnya dibawah ini disajikan rekapitulasi

peningkatanhasilpenelitiandariawalsampai

siklusII.

Tabel 1. Rekapitulasi Peningkatan HasilPenelitiandariAwalsampaiSiklusII.

Variabel Awal SiklusI SiklusIIRata-rata

Hasilyang

dicapai%

Kenaikan

Rata-rataKenaikan

Hasilyangdicapai

%Kenaikan

Rata-rataKenaikan

KemampuangurumenyusunRPPTematik 70 80,56 0,66 5,03 90,68 0,63 5,66

Dari data tersebut dapat diberikan pem-

bahasanbahwaupayayanggiatdilaksanakan

guru-gurubersamapenelitidalammembuat

RPP yang diharapkan dalam penelitian ini

menggunakan diskusi panel sudah dapat

mencapa i has i l sesua i harapan .Dar i

keberhasilan tersebut dapatlah diberikan

pertimbangan bahwa sampai tahap ini

penelitiansudahdianggapberhasilmencapai

tujuanyangsudahdirencanakan.

SIMPULANDANSARAN

Simpulan

Kebenaran data yang sudah didapat

dipergunakan untuk menjawab tujuan

penelitian. Penelitian ini bertujuan untuk

mengetahui seberapa tinggi kenaikan

kemampuanguruSDNKundurUtaramelalui

diskusi panel sebagai sarana menyusun

rencana pelaksanaan pembelajaran (RPP)

tematik.Datayangdiperolehdarikemampuan

guruAwalrata-ratanyaadalah70,padaSiklus

Imeningkatrata-ratanyamenjadi80,56,dan

Page 73: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

72 73

nganalisis data hasil penelitian ini adalah

metodedeskriptifkuantitatif.

Kisi-kisiInstrumenPenelitian

Kisi-kisi sangatpentingdibuatuntuk

memberi arah terhadap hal-hal yang di-

pertanyakan dalam instrumen penelitian.

Tujuan penyusunan kisi-kisi instrumen

adalahmerencanakansetepatmungkinruang

l ingkup dan tekanan tes dan bagian-

bagiannya, sehingga perumusan tersebut

dapat menjadi petunjuk ysng efektif bagi

penyusunan tes, terlebih-lebih bagi penulis

soal(Suryabrata,2000:60-61).

Indikator Kinerja/Kriteria Keberhasilan

Penelitian

Dalampenelitian ini diusulkan tingkat

keberhasilan per siklus yaitu siklus I di-

usulkan kemampuan guru menyusun RPP

mencapainilairata-rataBdenganskor71–85

danpadasiklusIIdiusulkankemampuanguru

sudah mencapai nilai rata-rata A (sangat

sempurna)denganskor86–100.

Kriteria:

A=sangatsempurna(skor86–100)

B=sempurna(skor71–85)

C=kurangsempurna(skor51–70)

D=tidaksempurna(skordibawah50)

HASILPENELITIANDANPEMBAHASAN

Adapun dilihat dari data awal guru

dalam menyusun Rencana Pelaksanaan

Pembelajaran (RPP) cukup rendah yaitu

masih mencapai nilai rata-rata 43,75% (7

orang)guru,dibawahnilai rata-rata31,25%

(5orang)guru,dandiatasnilairata-rata25%

(4orang)gurudenganskorrata-rata70yakni

nilaikualitatifrata-rataC(kurangsempurna),

maka perencanaan awal yang dilakukan

adalahmenyiapkan langkah-langkah diskusi

panel sebagai sarana meningkatkan ke-

mampuangurumenyusunRPPTematikSDN

KecamatanKundurUtara.

Untuk ini dilakukan dengan me-

nyiapkan ruangan diskusi panel dan me-

nggarahkan kepada bahan yang akan di-

diskusikansertawaktuyangtelahditentukan

dengan cara guru sekolah dasar negeri

kecamatanKundurUtaradikumpulkandiSDN

003KecamatanKundurUtara.

Persiapanyang sudah cukupmatang

dalam perencanaan ini adalah menyiapkan

jadwaldiskusipaneldanblankoRPPTematik

yang sudah diisi judul-judul yang mesti

dilakukan pada saat menulis RPP Tematik,

agarguru-gurudapatmelaksanakandengan

baikdanterarah.

Has i l yang d ipero leh dar i pe-

rencanaan adalah tercapainya kesepakatan

pertemuan diskusi panel dengan guru-guru

dan terselesainya blanko RPP perbaikan

dalam menyusun RPP Tematik yang me-

rupakan perbaikan-perbaikan perencanaan

pembelajarandanterlaksananyaarahanserta

bimbingan yang telah diberikan untuk hasil

rencana pelaksanaan pembelajaran tematik

yangberkualitas.

Pelaksanaanpenelitian Siklus I yaitu

mengumpulkanguruSDNKecamatanKundur

UtaradiSDN003KundurUtara yangsudah

disepakatimengingatguru-guruyangditeliti

berasal dari beberapa sekolah. Pelaksanaan

dimulai dengan menjelaskan pembelajaran

tematik, diteruskan dengan penyebaran

blanko RPP yang merupakan blanko per-

baikan cara-cara pembelajaran yangpenulis

kembangkan sendiri sebagaibentuk inovasi.

SetelahblankoRPPdibagikansebagaibahan

yang akan didiskusikan, dilanjutkan dengan

pendapat-pendapat guru-guru serta dapat

mengemukakan kesimpulan-kesimpulan

sehinggadiskusipaneldapatditutupdengan

baikdanlancar.

Penelitian ini, observasi atau pe-

ngamatan tertuju pada hal-hal seperti:

kebenaran penulisan indikator, kebenaran

menulis tujuan pembelajaran, konstruksi

yang dilakukan terhadap blanko RPP yang

diberikan serta kontribusi yang dapat

diberikan.Hal-hal tersebutmemangdiamati

oleh peneliti, namun yang menjadi acuan

akhiradalahkebenaranisiRPPtematikyang

dibuat karena tujuan penelitian ini adalah

untukmengetahui peningkatan kemampuan

guru-gurumenyusunRPPtematik.

AnalisisdanRe�leksiSiklus Idiambil

dari data hasil penelitian kemampuan guru

menyusun RPP yang mengikuti dengan

memasukkan unsur-unsur yang dituntut

dalampembelajarantematik.

Data memperlihatkan bahwa 37,5%

guru memperoleh skor rata-rata (6 orang),

sebanyak 31,25% guru memperoleh skor

dibawah rata-rata (5 orang), dan sebanyak

31,25% guru memperoleh skor diatas rata-

rata (5 orang). Sehingga dalam penyusunan

RPPtematikdari16oranggurudengannilai

rata-rata 80,56 (delapan puluh koma lima

puluh enam) klasi�ikasi B, masih perlu

diadakan diskusi panel untuk penyusunan

RPPtematikpadasiklusselanjutnya.

PadaSiklusIIinipenelitimelanjutkan

penelitian mulai dari perencanaan sampai

dengan analisis dan re�leksi Siklus II yakni

hasilyangdisampaikanpadasiklusIIadalah

terhadapRPPyangdisampaikangurusetelah

semuanya dilaksanakan dalam upaya per-

baikan.

Adapunhasilmemperlihatkanbahwa

43,75% guru memperoleh skor rata-rata (7

orang), sebanyak 31,25% gurumemperoleh

skor dibawah rata-rata (5 orang), dan

sebanyak 25%gurumemperolehskordiatas

rata-rata (4 orang). Sehingga dalam pe-

nyusunan RPP dari 16 orang guru dengan

nilai rata-rata 90,68 (Sembilan puluh koma

enam delapan) klasi�ikasi A. Nilai ini sudah

memenuhi kriteria usulan penilaian pada

Siklus IIyaituminimal86-100.Supaya lebih

jelasnya dibawah ini disajikan rekapitulasi

peningkatanhasilpenelitiandariawalsampai

siklusII.

Tabel 1. Rekapitulasi Peningkatan HasilPenelitiandariAwalsampaiSiklusII.

Variabel Awal SiklusI SiklusIIRata-rata

Hasilyang

dicapai%

Kenaikan

Rata-rataKenaikan

Hasilyangdicapai

%Kenaikan

Rata-rataKenaikan

KemampuangurumenyusunRPPTematik 70 80,56 0,66 5,03 90,68 0,63 5,66

Dari data tersebut dapat diberikan pem-

bahasanbahwaupayayanggiatdilaksanakan

guru-gurubersamapenelitidalammembuat

RPP yang diharapkan dalam penelitian ini

menggunakan diskusi panel sudah dapat

mencapa i has i l sesua i harapan .Dar i

keberhasilan tersebut dapatlah diberikan

pertimbangan bahwa sampai tahap ini

penelitiansudahdianggapberhasilmencapai

tujuanyangsudahdirencanakan.

SIMPULANDANSARAN

Simpulan

Kebenaran data yang sudah didapat

dipergunakan untuk menjawab tujuan

penelitian. Penelitian ini bertujuan untuk

mengetahui seberapa tinggi kenaikan

kemampuanguruSDNKundurUtaramelalui

diskusi panel sebagai sarana menyusun

rencana pelaksanaan pembelajaran (RPP)

tematik.Datayangdiperolehdarikemampuan

guruAwalrata-ratanyaadalah70,padaSiklus

Imeningkatrata-ratanyamenjadi80,56,dan

Page 74: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

74 75

padaSiklusIImeningkatmenjadi90,68.Data

tersebut membuktikan bahwa diskusi panel

sebagai sarana meningkatkan kemampuan

guru menyusun RPP tematik. Dari data

tersebutdapatdiambilsimpulanbahwapada

SiklusII initujuanpenelitiansudahtercapai

dan tidak perlu lagi dilanjutkan ke siklus

selanjutnya karena kriteria keberhasialn

penelitiansudahtercapai.

Saran

Walaupunpenelitian ini sudahdapat

membuktikan dengan diskusi panel dapat

meningkatkan kemampuan guru dalam

menyusun RPP tematik, sudah pasti dalam

penelitian ini masih banyak hal-hal yang

belumsempurnadilakukan.Olehkarenanya,

kepada peneliti lain yang berminatmeneliti

topikyangsamaagarmenelitibagian-bagian

yangbelumsempatditeliti.Bagipenelitilain

yanginginmemveri�ikasidatahasilpenelitian

ini diharapkan melakukan penelitian yang

samagunamelakukanpemeriksaanterhadap

kebenaranhasilyangsudahdidapatkan.

DAFTARPUSTAKA

Arikunto, dkk. 2006. Penelitian TindakanKelas.Jakarta:PT.BumiAksara.

Buchari Alma, 2008. Guru Professional .Bandung:AlfaBeta.

Daryanto, 2014. Pembelajaran TematikTerpadu, Terintegrasi (Kurikulum2013).Yogyakarta:GavaMedia.

Ku n a nd a r, 2 0 1 1 . Gu r u P r o f e s i o n a lImplementasi Kurikulum TingkatSatuanPendidikan (KTSP)danSuksesdalam Serti�ikasi Guru. Jakarta: PTRajawaliPers.

Mulyasa. 2007. Menjadi Guru Profesional,MenciptakanPembelajaranKreatifdanMenyenangkan.Bandung:Rosda.

Ramayulis, 2005.Metode Pendidikan AgamaIslam.Jakarta:KalamMulia.

Sudjana,Nana, 2009. Dasar-dasar ProsesBelajarMengajar.Bandung:Alfabeta.

Suryabrata, 2000. Pengembangan Alat UkurPsikologi.Yogyakarta:Andi.

Trianto, 2011. Desain PengembanganPembelajaranTematikBagiAnakUsiaDiniTK/RAdanAnakUsiaKelasAwalSD/MI.Jakarta:Kencana.

Usman, 1994. Menjadi Guru Profesional.Bandung:PT.RemajaRosdakarya.

PENGGUNAANMETODEBERMAINPERAN(ROLEPLAYING)UNTUKMENINGKATKANHASILBELAJARPKnMATERINILAI-NILAIDALAMPROSESPERUMUSANPANCASILASEBAGAIDASARNEGARAPADA

SISWAKELASVISDNEGERI016KUNDURKABUPATENKARIMUN

Mustafa*

Abstrak:PenelitiantindakankelasdilaksanakankepadasiswakelasVISekolahDasarNegeri016Kundur.Tujuandaripenelitianadalahmeningkatkanhasilbelajarsiswadenganmaterinilai-nilaiperjuangandalamperumusanPancasila.Dalamprosespembelajaran,gurumasihmenggunakanmetodekonvensionalyaituceramah, pemberian tugas, meringkas danmenghafalkan saja. Siswa belajar tidak bersemangat karenametodeyangdigunakansangatmembosankan.Merekamerasajenuhkarenaprosespembelajaranmonoton.Nilaisiswasangatrendahtidakmencapaikreteriaketuntasanminimalyaitu70.Usahauntukmeningkatkanhasilbelajar,peneliti menggunakanmetodebermainperan (roleplaying). Setelahdilaksanakanmetodetersebutprosespembelajaran telah tampak semangat siswabelajarkarenametodebermainperan (roleplaying)siswasecaralangsungmelakukanpembelajaran.Peningkatanhasilbelajarmulaiberubah.Prasiklusyangtidaktuntassebanyak10orang(41,67%),tuntassebanyak14orang(58,33%).PadasiklusIhasilbelajarmeningkatyangtidaktuntassebanyak7orang(29,83%)dantuntassebanyak17orang(70,83%).PadasiklusII.Semuasiswatelahmenuntaskanprosespembelajarandenganjumlah24orang(100%).Jadidapatdiambilkesimpulanbahwametodebermainperan(roleplaying)dapatmeningkatkansemangatdanhasilbelajarsiswadalampokokbahasanmenghargainilai-nilaijuangdalamprosesperumusanpancasilasebagaidasarnegara.

KataKunci:MetodeBermainPeran(RolePlaying),hasilbelajar,danPKn

PENDAHULUAN

Pelajaran PKn bertujuan untuk men-

jadikansiswamenghargaidanmenilaisetiap

orang dan masyarakat di sekitarnya. Mata

pelajaraninidiajarkanolehgurukepadasiswa

dengankompetensinya.Ternyatahasilbelajar

yang diperoleh sangat rendah. Penyebab

rendahnyadaripengamatanpeneliti antara

lainmatapelajaraninikurangdiminatisiswa

dengan alasan mata pelajaran ini sangat

mudah dicerna. Siswa tidak termotivasi

mempelajari materi PKn. Guru kurang

memberikan rangsangan, guru selalu

berperan untuk menyampaikan materi dan

siswa menerima ceramah. Sehingga proses

pembelajaranhanyamenerimasajadantidak

membuat akti�itas siswa untuk mendalami

pengetahuan.

Berdasarkan pengalaman, guru dalam

proses pembelajaran selalu menggunakan

metode ceramah dan memberikan tugas.

Metode ini kurang mengakti�kan siswa.

sehingga proses pembelajaran menjadi

monoton artinya siswa melakukan proses

pembelajarandariharikeharisamasajadan

tidakmengalamivariasi.Dalampembelajaran

PKnsebaiknyasiswadiajaklebihmenekankan

tujuan kompetensi terhadap materi

pelajaran.

Upaya dalam meningkatkan proses

pembelajaran dan hasil belajar siswa, perlu

diadakan pemilihan metode pembelajaran.

Untuk lebih membiasakan siswa dalam

menghayati materi pembelajaran dengan

menggunakan metode bermain peran (role

playing) dapat dijadikan suatu kebiasaan

untuk menjiwai materi karena metode ini

dapat menunjukkan contoh prilaku dalam

menghargainilai-nilai juangdanperumusan

pancasila sebagai dasar negara. Guru

sebaiknyamendorongsiswadalammenjiwai

makna daripada materi tersebut. Dengan

lebih aktifnya siswa semakin dekat siswa

mendalamidanmemilikipengetahuanmateri

PKn.

Page 75: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

74 75

padaSiklusIImeningkatmenjadi90,68.Data

tersebut membuktikan bahwa diskusi panel

sebagai sarana meningkatkan kemampuan

guru menyusun RPP tematik. Dari data

tersebutdapatdiambilsimpulanbahwapada

SiklusII initujuanpenelitiansudahtercapai

dan tidak perlu lagi dilanjutkan ke siklus

selanjutnya karena kriteria keberhasialn

penelitiansudahtercapai.

Saran

Walaupunpenelitian ini sudahdapat

membuktikan dengan diskusi panel dapat

meningkatkan kemampuan guru dalam

menyusun RPP tematik, sudah pasti dalam

penelitian ini masih banyak hal-hal yang

belumsempurnadilakukan.Olehkarenanya,

kepada peneliti lain yang berminatmeneliti

topikyangsamaagarmenelitibagian-bagian

yangbelumsempatditeliti.Bagipenelitilain

yanginginmemveri�ikasidatahasilpenelitian

ini diharapkan melakukan penelitian yang

samagunamelakukanpemeriksaanterhadap

kebenaranhasilyangsudahdidapatkan.

DAFTARPUSTAKA

Arikunto, dkk. 2006. Penelitian TindakanKelas.Jakarta:PT.BumiAksara.

Buchari Alma, 2008. Guru Professional .Bandung:AlfaBeta.

Daryanto, 2014. Pembelajaran TematikTerpadu, Terintegrasi (Kurikulum2013).Yogyakarta:GavaMedia.

Ku n a nd a r, 2 0 1 1 . Gu r u P r o f e s i o n a lImplementasi Kurikulum TingkatSatuanPendidikan (KTSP)danSuksesdalam Serti�ikasi Guru. Jakarta: PTRajawaliPers.

Mulyasa. 2007. Menjadi Guru Profesional,MenciptakanPembelajaranKreatifdanMenyenangkan.Bandung:Rosda.

Ramayulis, 2005.Metode Pendidikan AgamaIslam.Jakarta:KalamMulia.

Sudjana,Nana, 2009. Dasar-dasar ProsesBelajarMengajar.Bandung:Alfabeta.

Suryabrata, 2000. Pengembangan Alat UkurPsikologi.Yogyakarta:Andi.

Trianto, 2011. Desain PengembanganPembelajaranTematikBagiAnakUsiaDiniTK/RAdanAnakUsiaKelasAwalSD/MI.Jakarta:Kencana.

Usman, 1994. Menjadi Guru Profesional.Bandung:PT.RemajaRosdakarya.

PENGGUNAANMETODEBERMAINPERAN(ROLEPLAYING)UNTUKMENINGKATKANHASILBELAJARPKnMATERINILAI-NILAIDALAMPROSESPERUMUSANPANCASILASEBAGAIDASARNEGARAPADA

SISWAKELASVISDNEGERI016KUNDURKABUPATENKARIMUN

Mustafa*

Abstrak:PenelitiantindakankelasdilaksanakankepadasiswakelasVISekolahDasarNegeri016Kundur.Tujuandaripenelitianadalahmeningkatkanhasilbelajarsiswadenganmaterinilai-nilaiperjuangandalamperumusanPancasila.Dalamprosespembelajaran,gurumasihmenggunakanmetodekonvensionalyaituceramah, pemberian tugas, meringkas danmenghafalkan saja. Siswa belajar tidak bersemangat karenametodeyangdigunakansangatmembosankan.Merekamerasajenuhkarenaprosespembelajaranmonoton.Nilaisiswasangatrendahtidakmencapaikreteriaketuntasanminimalyaitu70.Usahauntukmeningkatkanhasilbelajar,peneliti menggunakanmetodebermainperan (roleplaying). Setelahdilaksanakanmetodetersebutprosespembelajaran telah tampak semangat siswabelajarkarenametodebermainperan (roleplaying)siswasecaralangsungmelakukanpembelajaran.Peningkatanhasilbelajarmulaiberubah.Prasiklusyangtidaktuntassebanyak10orang(41,67%),tuntassebanyak14orang(58,33%).PadasiklusIhasilbelajarmeningkatyangtidaktuntassebanyak7orang(29,83%)dantuntassebanyak17orang(70,83%).PadasiklusII.Semuasiswatelahmenuntaskanprosespembelajarandenganjumlah24orang(100%).Jadidapatdiambilkesimpulanbahwametodebermainperan(roleplaying)dapatmeningkatkansemangatdanhasilbelajarsiswadalampokokbahasanmenghargainilai-nilaijuangdalamprosesperumusanpancasilasebagaidasarnegara.

KataKunci:MetodeBermainPeran(RolePlaying),hasilbelajar,danPKn

PENDAHULUAN

Pelajaran PKn bertujuan untuk men-

jadikansiswamenghargaidanmenilaisetiap

orang dan masyarakat di sekitarnya. Mata

pelajaraninidiajarkanolehgurukepadasiswa

dengankompetensinya.Ternyatahasilbelajar

yang diperoleh sangat rendah. Penyebab

rendahnyadaripengamatanpeneliti antara

lainmatapelajaraninikurangdiminatisiswa

dengan alasan mata pelajaran ini sangat

mudah dicerna. Siswa tidak termotivasi

mempelajari materi PKn. Guru kurang

memberikan rangsangan, guru selalu

berperan untuk menyampaikan materi dan

siswa menerima ceramah. Sehingga proses

pembelajaranhanyamenerimasajadantidak

membuat akti�itas siswa untuk mendalami

pengetahuan.

Berdasarkan pengalaman, guru dalam

proses pembelajaran selalu menggunakan

metode ceramah dan memberikan tugas.

Metode ini kurang mengakti�kan siswa.

sehingga proses pembelajaran menjadi

monoton artinya siswa melakukan proses

pembelajarandariharikeharisamasajadan

tidakmengalamivariasi.Dalampembelajaran

PKnsebaiknyasiswadiajaklebihmenekankan

tujuan kompetensi terhadap materi

pelajaran.

Upaya dalam meningkatkan proses

pembelajaran dan hasil belajar siswa, perlu

diadakan pemilihan metode pembelajaran.

Untuk lebih membiasakan siswa dalam

menghayati materi pembelajaran dengan

menggunakan metode bermain peran (role

playing) dapat dijadikan suatu kebiasaan

untuk menjiwai materi karena metode ini

dapat menunjukkan contoh prilaku dalam

menghargainilai-nilai juangdanperumusan

pancasila sebagai dasar negara. Guru

sebaiknyamendorongsiswadalammenjiwai

makna daripada materi tersebut. Dengan

lebih aktifnya siswa semakin dekat siswa

mendalamidanmemilikipengetahuanmateri

PKn.

Page 76: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

76 77

Dengandemikianpenulismengharapkan

agarPenelitianinidapatmemperbaikiproses

pembelajaran serta meningkatkan keaktifan

danhasilbelajarsiswapadakompetensinilai-

nilai dalam proses perumusan pancasila

sebagai dasar yang mampu mempengaruhi

prestasidanhasilbelajarsiswakelasVISDN

016 Kundur Kabupaten Karimun. Untuk itu

peneliti tertarik untuk mengadakan pe-

nelitiantentang“PenggunaanMetodeBermain

Peran (Role Playing) untuk Meningkatkan

Hasil Belajar PKn Materi Nilai-Nilai dalam

Proses Perumusan Pancasila Sebagai Dasar

NegarapadaSiswaKelasVISDN016Kundur

KabupatenKarimun”.

Rumusan masalah dalam penelitian ini

adalah ''Apakahmelaluipenggunaanmetode

bermain peran (role playing) dapat me-

ningkatkan hasil belajar PKn pada materi

nilai-nilai perjuangan dalam perumusan

pancasilapadasiswakelasVISDN016Kundur

KabupatenKarimun?”

Tujuan penelitian tindakan kelas ini

adalahuntukmeningkatkanhasilbelajarPKn

pada materi nilai-nilai perjuangan dalam

perumusanpancasilapadasiswakelasVISDN

016 Kundur Kabupaten Karimun. Hasil

penelitian inidiharapkandapat bermanfaat

berbagai pihak yaitu: 1) Bagi Guru: a)

Meningkatkan kinerja guru dalam me-

ningkatkan mutu pendidikan pada mata

pelajaran yang diajarkannya; b) Membantu

teman sejawat dalam memperbaiki kinerja

gurudalamprosespembelajaran;c)Memiliki

rasa tanggung jawab dan menambah ke-

percayaanterhadapdiriguru;2)BagiSiswa:

a) Mampumemperbaiki cara belajar secara

langsung maupun tidak langsung; b)

Meningkatkan motivasi belajar siswa; c)

Menumbuhkanpercayadiriterhadapdirinya

sendiri;3)BagiSekolah:a)Menginformasikan

kepada guru lainnya dalam menggunakan

metodeyang tepat sesuaidenganmateri;b)

Meningkatkanhasilkelulusansiswa;c)Dapat

membatasi masalah guru dalam meng-

gunakanmetodebelajar;4)BagiPeneliti:a)

Dapat menambah pengetahuan dalam

melakukan penelitian tindakan kelas; b)

Sebagai pedoman untuk peneliti dan

penelitianberikutnya.

Metode Penelitian Bermain Peran

(Role Playing)

Metode penelitian ini menggunakan

metode bermain peran. (Role Playing).

Metode bermain peran (Role Playing)

menurutBennyAPribadi(2011:44)bermain

peran (Role Playing) merupakan kegiatan

belajardalamsebuahsituasiyangmendekati

situasi sesungguhnya. Dalam metode ini

biasanya digunakan model yang realistik.

Dalam metode pembelajaran ini, siswa

diminta memerankan sesuatu yang belum

pernahdialamisebelumnya.

Pembelajaran dengan metode bermain

peran (Role Playing) adalah pembelajaran

dengancaraseolah-olahberadadalamsuatu

situasiuntukmemperolehsuatupemahaman

tentangsuatukonsep.Dalammetodeinisiswa

berkesempatanterlibatsecaraaktifsehingga

akanlebihmemahamikonsepdanlebihlama

mengingat, tetapi memerlukan waktu lama.

Roetiyah, N.K. (2008:90) siswa dapat

mendramatisasikan tingkah laku ungkapan

gerakgerik,wajahseseorangdalamhubungan

sosialantarmanusiaataudenganroleplaying

dimanasiswabisaberperanataumemainkan

peranan dalam dramatisasi masalah sosial/

psikologisitu.

Jadi dari uraian di atas, dapat diambil

kesimpulan bahwa metode bermain peran

(roleplaying) adalahbelajar dalamsebuah

situasi yang sesungguhnya yang belum

pernah dialaminya dan seakan-akan siswa

memahami suatu konsep dan lebih lama

diingat melalui dramatisasi dengan gerak

gerikwajahseseorangdalamhubungansosial

psikologis.

Kelebihan dan kekurangan Metode

Bermain Peran (Role Playing), menurut

Dariman (2013:144) kelebihan metode

bermainperan(roleplaying)yaitu:1)Segera

mendapat perhatian, 2) Dapat dipakai pada

kelompok besar dan kecil, 3) Membantu

anggota untuk menganalisis situasi, 4)

Menambahrasapercayadiripadapeserta,5)

Membantu anggota dan siswa untuk

menyelami masalah, 6) Membantu anggtia

mendapatkan pengalaman yang ada pada

pikiranoranglain,Membangkitkanminatdan

perhatian pada saat untuk memecahkan

masalah.Sedangkankekurangannyayaitu:1)

Bermain peran tidak akan berjalan dengan

baikjikasuasanakelastidakmendukung;2)

Bermainperantidakselamanyamenujuarah

yang diharapkan seseorang yang mema-

inkannya. Bahkan juga mungkin akan

berlawanandenganapayangdiharapkannya;

3) Siswa sering mengalami kesulitan untuk

memerankan peran secara baik. Khususnya

jikasiswatidakdiarahkandenganbaik.Siswa

perlumengenal dengan baik apa yang akan

diperankannya; 4) Bermain memerlukan

waktuyangbanyak;5)Untukdapatberjalan

dengan baik, dalam bermain peran (role

playing) diperlukan kelompok yang sesitif,

imajinatif,terbuka,seringmengenalsehingga

dapatbnekerjasamadenganbaik.

Dari uraian di atas dapat disimpulkan

bahwabermainperandapatmengembangkan

serta membangkitkan daya imajinatif siswa

dalam proses pembelajaran sehingga siswa

dapatmelakukankerjasamayangbaikdalam

mengambilkeputusanpembelajaran.Manfaat

penggunaan metode bermain peran (role

playing) yaitu: 1) Membantu siswa me-

nemukanmaknadirinyadalamkelompok;2)

Membantu siswa memecahkan persoalan

pribadi dengan bantuan kelompok; 3)

Memberi pengalaman bekerjasama dalam

memecahkan masalah; 4) Memberi siswa

pengalaman mengembangkan sikap ke-

trampilanmemecahkanmasalah.

MateriPembelajaanPKn

Materi pembelajaran PKn nilai-nilai

perjuangandalamperumusanpancasilapara

tokoh perumus Piagam Jakarta telah

menunjukkan jiwa besar dan semangat

nasionalisme yang tinggi.Merekamenerima

keputusan besama dalam sidang PPKI dan

lebih mementingkan kepentingan bersama

(bangsa dan negara) daripada kepentingan

pribadidangolongan.

BelajardanPembelajaran

Belajar,menurutAunurahman(2012:

18) belajar merupakan suatu proses

mengasimilasikan dan menghubungkan

bahan yang dipelajari dengan pengalaman-

pengalaman yang dimiliki seseorang,

sehinggga pengetahuannya tentang objek

tertentu menjadi lebih kokoh. Wragg

(1994:35) membagi tiga bagian ciri-ciri

belajar yaitu pertama, belajar menunjukkan

suatu aktivitas pada diri seseorang yang

disadari atau disengaja. Kedua belajar

merupakan interaksi individu dengan

lingkungan-lingkungan dalam hal ini dapat

berupa manusia dan objek-objek lain yang

memungkinkan individu memperoleh

pengalaman-pengalaman atau pengetahuan

barumaupunsesuatuyangpernahdiperoleh

atau ditemukan sebelumnya akan tetapi

Page 77: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

76 77

Dengandemikianpenulismengharapkan

agarPenelitianinidapatmemperbaikiproses

pembelajaran serta meningkatkan keaktifan

danhasilbelajarsiswapadakompetensinilai-

nilai dalam proses perumusan pancasila

sebagai dasar yang mampu mempengaruhi

prestasidanhasilbelajarsiswakelasVISDN

016 Kundur Kabupaten Karimun. Untuk itu

peneliti tertarik untuk mengadakan pe-

nelitiantentang“PenggunaanMetodeBermain

Peran (Role Playing) untuk Meningkatkan

Hasil Belajar PKn Materi Nilai-Nilai dalam

Proses Perumusan Pancasila Sebagai Dasar

NegarapadaSiswaKelasVISDN016Kundur

KabupatenKarimun”.

Rumusan masalah dalam penelitian ini

adalah ''Apakahmelaluipenggunaanmetode

bermain peran (role playing) dapat me-

ningkatkan hasil belajar PKn pada materi

nilai-nilai perjuangan dalam perumusan

pancasilapadasiswakelasVISDN016Kundur

KabupatenKarimun?”

Tujuan penelitian tindakan kelas ini

adalahuntukmeningkatkanhasilbelajarPKn

pada materi nilai-nilai perjuangan dalam

perumusanpancasilapadasiswakelasVISDN

016 Kundur Kabupaten Karimun. Hasil

penelitian inidiharapkandapat bermanfaat

berbagai pihak yaitu: 1) Bagi Guru: a)

Meningkatkan kinerja guru dalam me-

ningkatkan mutu pendidikan pada mata

pelajaran yang diajarkannya; b) Membantu

teman sejawat dalam memperbaiki kinerja

gurudalamprosespembelajaran;c)Memiliki

rasa tanggung jawab dan menambah ke-

percayaanterhadapdiriguru;2)BagiSiswa:

a) Mampumemperbaiki cara belajar secara

langsung maupun tidak langsung; b)

Meningkatkan motivasi belajar siswa; c)

Menumbuhkanpercayadiriterhadapdirinya

sendiri;3)BagiSekolah:a)Menginformasikan

kepada guru lainnya dalam menggunakan

metodeyang tepat sesuaidenganmateri;b)

Meningkatkanhasilkelulusansiswa;c)Dapat

membatasi masalah guru dalam meng-

gunakanmetodebelajar;4)BagiPeneliti:a)

Dapat menambah pengetahuan dalam

melakukan penelitian tindakan kelas; b)

Sebagai pedoman untuk peneliti dan

penelitianberikutnya.

Metode Penelitian Bermain Peran

(Role Playing)

Metode penelitian ini menggunakan

metode bermain peran. (Role Playing).

Metode bermain peran (Role Playing)

menurutBennyAPribadi(2011:44)bermain

peran (Role Playing) merupakan kegiatan

belajardalamsebuahsituasiyangmendekati

situasi sesungguhnya. Dalam metode ini

biasanya digunakan model yang realistik.

Dalam metode pembelajaran ini, siswa

diminta memerankan sesuatu yang belum

pernahdialamisebelumnya.

Pembelajaran dengan metode bermain

peran (Role Playing) adalah pembelajaran

dengancaraseolah-olahberadadalamsuatu

situasiuntukmemperolehsuatupemahaman

tentangsuatukonsep.Dalammetodeinisiswa

berkesempatanterlibatsecaraaktifsehingga

akanlebihmemahamikonsepdanlebihlama

mengingat, tetapi memerlukan waktu lama.

Roetiyah, N.K. (2008:90) siswa dapat

mendramatisasikan tingkah laku ungkapan

gerakgerik,wajahseseorangdalamhubungan

sosialantarmanusiaataudenganroleplaying

dimanasiswabisaberperanataumemainkan

peranan dalam dramatisasi masalah sosial/

psikologisitu.

Jadi dari uraian di atas, dapat diambil

kesimpulan bahwa metode bermain peran

(roleplaying) adalahbelajar dalamsebuah

situasi yang sesungguhnya yang belum

pernah dialaminya dan seakan-akan siswa

memahami suatu konsep dan lebih lama

diingat melalui dramatisasi dengan gerak

gerikwajahseseorangdalamhubungansosial

psikologis.

Kelebihan dan kekurangan Metode

Bermain Peran (Role Playing), menurut

Dariman (2013:144) kelebihan metode

bermainperan(roleplaying)yaitu:1)Segera

mendapat perhatian, 2) Dapat dipakai pada

kelompok besar dan kecil, 3) Membantu

anggota untuk menganalisis situasi, 4)

Menambahrasapercayadiripadapeserta,5)

Membantu anggota dan siswa untuk

menyelami masalah, 6) Membantu anggtia

mendapatkan pengalaman yang ada pada

pikiranoranglain,Membangkitkanminatdan

perhatian pada saat untuk memecahkan

masalah.Sedangkankekurangannyayaitu:1)

Bermain peran tidak akan berjalan dengan

baikjikasuasanakelastidakmendukung;2)

Bermainperantidakselamanyamenujuarah

yang diharapkan seseorang yang mema-

inkannya. Bahkan juga mungkin akan

berlawanandenganapayangdiharapkannya;

3) Siswa sering mengalami kesulitan untuk

memerankan peran secara baik. Khususnya

jikasiswatidakdiarahkandenganbaik.Siswa

perlumengenal dengan baik apa yang akan

diperankannya; 4) Bermain memerlukan

waktuyangbanyak;5)Untukdapatberjalan

dengan baik, dalam bermain peran (role

playing) diperlukan kelompok yang sesitif,

imajinatif,terbuka,seringmengenalsehingga

dapatbnekerjasamadenganbaik.

Dari uraian di atas dapat disimpulkan

bahwabermainperandapatmengembangkan

serta membangkitkan daya imajinatif siswa

dalam proses pembelajaran sehingga siswa

dapatmelakukankerjasamayangbaikdalam

mengambilkeputusanpembelajaran.Manfaat

penggunaan metode bermain peran (role

playing) yaitu: 1) Membantu siswa me-

nemukanmaknadirinyadalamkelompok;2)

Membantu siswa memecahkan persoalan

pribadi dengan bantuan kelompok; 3)

Memberi pengalaman bekerjasama dalam

memecahkan masalah; 4) Memberi siswa

pengalaman mengembangkan sikap ke-

trampilanmemecahkanmasalah.

MateriPembelajaanPKn

Materi pembelajaran PKn nilai-nilai

perjuangandalamperumusanpancasilapara

tokoh perumus Piagam Jakarta telah

menunjukkan jiwa besar dan semangat

nasionalisme yang tinggi.Merekamenerima

keputusan besama dalam sidang PPKI dan

lebih mementingkan kepentingan bersama

(bangsa dan negara) daripada kepentingan

pribadidangolongan.

BelajardanPembelajaran

Belajar,menurutAunurahman(2012:

18) belajar merupakan suatu proses

mengasimilasikan dan menghubungkan

bahan yang dipelajari dengan pengalaman-

pengalaman yang dimiliki seseorang,

sehinggga pengetahuannya tentang objek

tertentu menjadi lebih kokoh. Wragg

(1994:35) membagi tiga bagian ciri-ciri

belajar yaitu pertama, belajar menunjukkan

suatu aktivitas pada diri seseorang yang

disadari atau disengaja. Kedua belajar

merupakan interaksi individu dengan

lingkungan-lingkungan dalam hal ini dapat

berupa manusia dan objek-objek lain yang

memungkinkan individu memperoleh

pengalaman-pengalaman atau pengetahuan

barumaupunsesuatuyangpernahdiperoleh

atau ditemukan sebelumnya akan tetapi

Page 78: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

78 79

menimbulkanperhatiankembali.Ketigahasil

belajar ditandai dengan perubahan tingkah

laku. Walaupun tidak semua perubahan

tingkah laku merupakan hasil belajar akan

tetapi aktivitas belajar umumnya disertai

tingkahlaku.

Sedangkan menurut W. Gulo (2011:

73) menyatakan belajar adalah seperangkat

kegiatan, terutama kegiatan mental in-

telektual, mulai dari kegiatan yang paling

sederhanasampaikegiatanyangrumit.Pada

tahap pertama, kegiatan ini tampak seperti

kegiatan �isik, dalam arti kegiatan melihat,

mendengar, meraba, dengan alat-alat indera

manusia.Kegiataninidilakukanuntukkontak

denganstimulusataubahanyangdipelajari.

Jadi dari uraian ketiga ahli tersebut

disimpulkan bahwa secara umum belajar

merupakanaktivitaspadadiriseseorangyang

disadariataudisengaja.Suatuprosesinteraksi

individu dengan lingkungan-lingkungan dan

mendapatkan pengalaman-pengalaman atau

pengetahuan, terutama kegiatan mental

intelektual, mulai dari kegiatan yang paling

sederhanasampaikegiatanyangrumit.Secara

khusus dalam belajar tentang materi nilai-

nilaiperjuangandalamperumusanpancasila,

pengalaman moral, semangat para tokoh

pejuang harus ditiru. Mereka telah mem-

baktikan dirinya untuk kepentingan bangsa

dan negara. Adapun yang harus dipelajari

adalahtentangmoralyangharusdimilikioleh

siswayaitu pantangmenyerah,lapangdada,

rasatanggungjawab,salingmenghormatidan

menghargai. Nilai-nilai kebersamaan dalam

perumusanPancasilasiswadapatmenghargai

pendapat orang tua, menerima keputusan

bersama,melaksanakankeputusanbersama.

Pembelajaran, menurut E. Brunner

(dalam Suyanto, 2009:37) pembelajaran

harusdisesuaikandenganminat anak.Anak

harusdidoronguntukmelakukaneksplorasi

dan belajar sendiri. Minat anak tidak bisa

dipaksakankarenadiaakanmuncul sendiri.

Ada rasa keingintahuannya terhadapmateri

dalamprosespembelajaran, selain itu siswa

berhasrat dan bersemangat dalam kegiatan

belajar mandiri. Rudi Susilana dan Cepi

Riyana (2009:1) menyatakan pembelajaran

merupakan suatu kegiatan yangmelibatkan

seseorang dalam upaya memperoleh

pengetahuan keterampilan dan nilai-nilai

positif dengan memanfaatkan berbagai

sumber untuk belajar. Siswa berusaha

mencari sumber lain baik darimedia cetak,

media elektronik atau narasumber yang

terkait dengan materi pelajarannya untuk

dipelajarinya, sehingga ilmu pengetahuan,

keterampilan dan nilai-nilai positif ter-

bentuklahsatukesatuanbelajarsendiri.

Dariuraiandiatasdapatdisimpulkan

bahwa pembelajaran adalah suatu proses

keingintahuan terhadap materi belajar dan

melibatkan siswa untuk memperoleh

pengetahuan,sikap,danketerampilan serta

mendorongsiswauntukmencarimediacetak

atau elektronik diluar dari materi untuk

bahanpendukungbelajarnya.

Hasil Belajar, menurut Wahidmurni,

dkk(2010:18)menjelaskanbahwaseseorang

dapatdikatakantelahberhasildalambelajar

jika ia mampu menunjukkan adanya

perubahandalamdirinya.Perubahantersebut

diantaranya dari segi kemampuan ber-

pikirnya, keterampilannya, atau sikapnya

terhadap suatu objek. Hasil belajar secara

umum adalah hasil yang diperoleh siswa

setelah melaksanakan proses pembelajaran.

Pengalaman dari proses yang dialaminya

terjadi perubahan tingkah laku. Secara

khusus bahwa hasil belajar siswa dalam

pembelajaran PKnmaterimenghargai nilai-

nilai juang dalam proses perumusan

pancasilasebagaidasarnegaratelahberhasil

bilasiswatelahmengikutisemuasiklus.

Selain itu hasil dari proses pem-

belajaran pancasila yaitu: 1) pantang

menyerah,2)relaberkorban,3)lapangdada,

4) rasa tanggung jawab, 5) saling meng-

hormati dan menghargai. Menghargai nilai-

nilai juang dalam proses perumusan

pancasila yaitu pertama menghargai pen-

dapatoranglaindiantaranyaadalah:1)sopan,

2)tidakmemaksakanpendapatoranglain,3)

tidak menyimpang dari pembicaraan atau

masalahyangdihadapi, 4) tidakmemotong

pembicaraan orang lain, 5) isi pembicaraan

mengutamakan kepentingan bersama, 6)

sesuai dengan nilai-nilai pancasila. Kedua

menerima keputusan bersama. Ketiga

melaksanakankeputusanbersama.

Hambatan-hambatanBelajar

Menurut Dimyati dan Mudjiono

(2006:247),Anonim(2011)danMitra(2011)

dan Slameto (faktor yang mempengaruhi

dalambelajardapatdibagimenjadiduayaitu

faktorinstrinsikdanfaktorekstrinsik.Faktor

instrinsik adalah faktor yang ada pada diri

siswa sendiri seperti: 1) Kondisi �isik

(biologis) belajar. biologis, seperti cacatan

tubuh,kurangpendengaran,rasarendahdiri,

2) Kondisi psikologis siswa sendiri, in-

telegensirendah,3)Kejenuhanbelajar,tidak

merasasenangdengansubjekyangdipelajari,

4)Tidakmengetahuimanfaartyangdipelajari,

5) Tingkat intektualitas, 6) Kecerdasan

intelegensi question (IQ) siswa sendiri, 7)

Konsentrasi belajar yang rendah, 8) bosan

dalam belajar, 9) Tidak memahami tentang

pemanfaatankegitanbelajar.

Berikut faktor penghambat dari luar

siswasendiriyaitu:1)Gurusebagaipembina

belajar selain mengajar juga mendiri

kemudian dapat mengetahui kepribadian

siswanya dalam proses pembelajaran, 2)

Prasarana dan sarana pembelajaran di

sekolah harus lengkap yang disediakan oleh

pemerintahuntukpelaksanaanpembelajaran,

3) Kebijakan penilaian pada akhir belajar,

sebagai suatu hasil dengan unjuk kerja

tersebut proses belajar berhenti untuk

sementara.penilaianhasilbelajardatangnnya

darigurukarenagurusebagaipenentuhasil

belajar siswa, 4) Lingkungan sosial siswa di

sekolah, 5) Kurikulum sekolah yang selalu

berubah-ubah, 6) Bahan materi tidak

memadai,dantingkatkesukaransubjekyang

dipelajari, 7) Faktor ekonomi siswa sendiri

yang masih di bawah standar penghasilan

upahkerja.

METODOLOGI PENELITIAN

Jenis Penelitian

Menurut Suhardjono (2007:58) Pe-

nelitian Tindakan Kelas (PTK) adalah

penelitian tindakan yang dilakukan di kelas

dengan tujuan memperbaiki atau me-

ningkatkanmutupraktikpembelajaran.Masih

banyak proses pembelajaran guru belum

dapatmeningkatkanmutuatauhasilbelajar

siswa. Banyak aspek yang perlu diperbaiki

untuk menambah kinerja guru seperti

penggunaan metode, penyampaian materi,

dan selalu memperhatikan re�leksi diri.

Wardani,IGAK(2012:14)penelitiantindakan

kelas adalah penelitian yang dilakukan oleh

gurudi dalamkelas sendiri,melalui re�leksi

diri, dengan tujuan untuk memperbaiki

kinerja sebagai seorang guru, sehinggahasil

belajarsiswamenjadimeningkat.

Penelitiantindakankelasmerupakan

kegiatanguruuntukmemperbaikikinerjanya

Page 79: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

78 79

menimbulkanperhatiankembali.Ketigahasil

belajar ditandai dengan perubahan tingkah

laku. Walaupun tidak semua perubahan

tingkah laku merupakan hasil belajar akan

tetapi aktivitas belajar umumnya disertai

tingkahlaku.

Sedangkan menurut W. Gulo (2011:

73) menyatakan belajar adalah seperangkat

kegiatan, terutama kegiatan mental in-

telektual, mulai dari kegiatan yang paling

sederhanasampaikegiatanyangrumit.Pada

tahap pertama, kegiatan ini tampak seperti

kegiatan �isik, dalam arti kegiatan melihat,

mendengar, meraba, dengan alat-alat indera

manusia.Kegiataninidilakukanuntukkontak

denganstimulusataubahanyangdipelajari.

Jadi dari uraian ketiga ahli tersebut

disimpulkan bahwa secara umum belajar

merupakanaktivitaspadadiriseseorangyang

disadariataudisengaja.Suatuprosesinteraksi

individu dengan lingkungan-lingkungan dan

mendapatkan pengalaman-pengalaman atau

pengetahuan, terutama kegiatan mental

intelektual, mulai dari kegiatan yang paling

sederhanasampaikegiatanyangrumit.Secara

khusus dalam belajar tentang materi nilai-

nilaiperjuangandalamperumusanpancasila,

pengalaman moral, semangat para tokoh

pejuang harus ditiru. Mereka telah mem-

baktikan dirinya untuk kepentingan bangsa

dan negara. Adapun yang harus dipelajari

adalahtentangmoralyangharusdimilikioleh

siswayaitu pantangmenyerah,lapangdada,

rasatanggungjawab,salingmenghormatidan

menghargai. Nilai-nilai kebersamaan dalam

perumusanPancasilasiswadapatmenghargai

pendapat orang tua, menerima keputusan

bersama,melaksanakankeputusanbersama.

Pembelajaran, menurut E. Brunner

(dalam Suyanto, 2009:37) pembelajaran

harusdisesuaikandenganminat anak.Anak

harusdidoronguntukmelakukaneksplorasi

dan belajar sendiri. Minat anak tidak bisa

dipaksakankarenadiaakanmuncul sendiri.

Ada rasa keingintahuannya terhadapmateri

dalamprosespembelajaran, selain itu siswa

berhasrat dan bersemangat dalam kegiatan

belajar mandiri. Rudi Susilana dan Cepi

Riyana (2009:1) menyatakan pembelajaran

merupakan suatu kegiatan yangmelibatkan

seseorang dalam upaya memperoleh

pengetahuan keterampilan dan nilai-nilai

positif dengan memanfaatkan berbagai

sumber untuk belajar. Siswa berusaha

mencari sumber lain baik darimedia cetak,

media elektronik atau narasumber yang

terkait dengan materi pelajarannya untuk

dipelajarinya, sehingga ilmu pengetahuan,

keterampilan dan nilai-nilai positif ter-

bentuklahsatukesatuanbelajarsendiri.

Dariuraiandiatasdapatdisimpulkan

bahwa pembelajaran adalah suatu proses

keingintahuan terhadap materi belajar dan

melibatkan siswa untuk memperoleh

pengetahuan,sikap,danketerampilan serta

mendorongsiswauntukmencarimediacetak

atau elektronik diluar dari materi untuk

bahanpendukungbelajarnya.

Hasil Belajar, menurut Wahidmurni,

dkk(2010:18)menjelaskanbahwaseseorang

dapatdikatakantelahberhasildalambelajar

jika ia mampu menunjukkan adanya

perubahandalamdirinya.Perubahantersebut

diantaranya dari segi kemampuan ber-

pikirnya, keterampilannya, atau sikapnya

terhadap suatu objek. Hasil belajar secara

umum adalah hasil yang diperoleh siswa

setelah melaksanakan proses pembelajaran.

Pengalaman dari proses yang dialaminya

terjadi perubahan tingkah laku. Secara

khusus bahwa hasil belajar siswa dalam

pembelajaran PKnmaterimenghargai nilai-

nilai juang dalam proses perumusan

pancasilasebagaidasarnegaratelahberhasil

bilasiswatelahmengikutisemuasiklus.

Selain itu hasil dari proses pem-

belajaran pancasila yaitu: 1) pantang

menyerah,2)relaberkorban,3)lapangdada,

4) rasa tanggung jawab, 5) saling meng-

hormati dan menghargai. Menghargai nilai-

nilai juang dalam proses perumusan

pancasila yaitu pertama menghargai pen-

dapatoranglaindiantaranyaadalah:1)sopan,

2)tidakmemaksakanpendapatoranglain,3)

tidak menyimpang dari pembicaraan atau

masalahyangdihadapi, 4) tidakmemotong

pembicaraan orang lain, 5) isi pembicaraan

mengutamakan kepentingan bersama, 6)

sesuai dengan nilai-nilai pancasila. Kedua

menerima keputusan bersama. Ketiga

melaksanakankeputusanbersama.

Hambatan-hambatanBelajar

Menurut Dimyati dan Mudjiono

(2006:247),Anonim(2011)danMitra(2011)

dan Slameto (faktor yang mempengaruhi

dalambelajardapatdibagimenjadiduayaitu

faktorinstrinsikdanfaktorekstrinsik.Faktor

instrinsik adalah faktor yang ada pada diri

siswa sendiri seperti: 1) Kondisi �isik

(biologis) belajar. biologis, seperti cacatan

tubuh,kurangpendengaran,rasarendahdiri,

2) Kondisi psikologis siswa sendiri, in-

telegensirendah,3)Kejenuhanbelajar,tidak

merasasenangdengansubjekyangdipelajari,

4)Tidakmengetahuimanfaartyangdipelajari,

5) Tingkat intektualitas, 6) Kecerdasan

intelegensi question (IQ) siswa sendiri, 7)

Konsentrasi belajar yang rendah, 8) bosan

dalam belajar, 9) Tidak memahami tentang

pemanfaatankegitanbelajar.

Berikut faktor penghambat dari luar

siswasendiriyaitu:1)Gurusebagaipembina

belajar selain mengajar juga mendiri

kemudian dapat mengetahui kepribadian

siswanya dalam proses pembelajaran, 2)

Prasarana dan sarana pembelajaran di

sekolah harus lengkap yang disediakan oleh

pemerintahuntukpelaksanaanpembelajaran,

3) Kebijakan penilaian pada akhir belajar,

sebagai suatu hasil dengan unjuk kerja

tersebut proses belajar berhenti untuk

sementara.penilaianhasilbelajardatangnnya

darigurukarenagurusebagaipenentuhasil

belajar siswa, 4) Lingkungan sosial siswa di

sekolah, 5) Kurikulum sekolah yang selalu

berubah-ubah, 6) Bahan materi tidak

memadai,dantingkatkesukaransubjekyang

dipelajari, 7) Faktor ekonomi siswa sendiri

yang masih di bawah standar penghasilan

upahkerja.

METODOLOGI PENELITIAN

Jenis Penelitian

Menurut Suhardjono (2007:58) Pe-

nelitian Tindakan Kelas (PTK) adalah

penelitian tindakan yang dilakukan di kelas

dengan tujuan memperbaiki atau me-

ningkatkanmutupraktikpembelajaran.Masih

banyak proses pembelajaran guru belum

dapatmeningkatkanmutuatauhasilbelajar

siswa. Banyak aspek yang perlu diperbaiki

untuk menambah kinerja guru seperti

penggunaan metode, penyampaian materi,

dan selalu memperhatikan re�leksi diri.

Wardani,IGAK(2012:14)penelitiantindakan

kelas adalah penelitian yang dilakukan oleh

gurudi dalamkelas sendiri,melalui re�leksi

diri, dengan tujuan untuk memperbaiki

kinerja sebagai seorang guru, sehinggahasil

belajarsiswamenjadimeningkat.

Penelitiantindakankelasmerupakan

kegiatanguruuntukmemperbaikikinerjanya

Page 80: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

80 81

Tahap Observasi atau Pengamatan,

Teman sejawat, pembimbing melakukan

observasi terhadap peneliti melakukan

kegiatanpembelajarandenganmenggunakan

metode bermain peran (role playing).

Pengamatan dilakukan mulai pelaksanaan

proses pembelajaran sampai berakhirnya

pembelajaran.

TahapRe�leksi,TahapRe�leksisetelah

diadakandiskusimasihbelumberhasilkarena

masih ada siswa yang mendapatkan nilai

kurang dari ketentuan kriteria ketuntasan

minimal mata pelajaran. Untuk itu perlu

diadakanperbaikanpembelajaranpadasiklus

II. Semua kejadian baik kelemahan dan

kelebihan proses pembelajaran pada siklus

berikutnya tidak akan terulang kembali dan

diharapkanbahwasiklusIIakanberhasil.

Siklus II, Pelaksanaan pada siklus I

telahdiadakandiskusidengantemansejawat,

pembimbing, telah disepakati bahwa

pelaksanaan pada siklus I belum men-

dapatkanhasilyangdiharapkankarenamasih

ada pelaksanaan guru yang masih belum

tercapai. Untuk itu pada siklus II akan

diperbaiki proses pembelajarannya. Pada

siklus II sebelum melaksanakan perbaikan

pembelajaran, guru menyusun rencana

perbaikan yaitu menyusun RPP, membuat

format guru dan siswa, menyusun naskah

pelajaran,membuattesatauevaluasiakhir.

PelaksanaanpadasiklusIIterbagimenjadi

tiga kegiatan dalam prosedur pembelajaran.

a) Kegiatan awal, tahap pelaksanaan dalam

kegiatan awal yaitu: 1) Guru mengucapkan

salamkepadasemuasiswa,2)Gurumengatur

tempat duduk dan pembagian kelompok, 3)

Membacadoayangdipimpinolehketuakelas,

4)Gurumengabsen siswa, danmenanyakan

bila ada siswa yang tidak datang, 5) Guru

mengadakan apersepsi untuk melanjutkan

proses pembelajaran, 6) Guru mem-

beritahukan bahwa tujuan pembelajaran, 6)

Gurumemotivasisiswaagarseriusmengikuti

proses pembelajaran. b) Kegiatan Inti, pada

kegiatan inti, telah disiapkan oleh guru dan

siswa naskah untuk dilakukan dalam

menjiwaimaterimenghargainilai-nilaijuang

dalam proses perumusan Pancasila bagi

negara: 1) Penyajian kelompok satu

mempraktekkan naskah yang telah dibuat

sesuai dengan materi pembelajaran; 2)

Kelompok lain mengadakan pengamatan

terhadap kelompok yang tampil; 3) Guru

membimbing siswa dalam menganalisis

setiap kegiatan yang telah ditambilkan; 4)

Guru menyimpulkan pelajaran; c) Kegiatan

akhir:1)Evaluasiuntukmelihatpendalaman

terhadapnilai-nilaijuangsiswadalampokok

bahasan;2)Tindaklanjut.

Tahap Observasi atau Pengamatan,

teman sejawat, pembimbing melakukan

observasi terhadap peneliti melakukan

kegiatanpembelajarandenganmenggunakan

metode bermain peran (role playing)

Pengamatan dilakukan mulai pelaksanaan

proses pembelajaran sampai berakhirnya

pembelajaran.

TahapRe�leksi,tahapRe�leksisetelah

diadakan diskusi masih belum berhasil

karenamasih ada siswa yangmendapatkan

nilai kurang dari ketentuan kriteria ke-

tuntasanminimalmata pelajaran. Untuk itu

perludiadakanperbaikanpembelajaranpada

siklusII.Semuakejadianbaikkelemahandan

kelebihan proses pembelajaran pada siklus

beikutnya tidak akan terulang kembali dan

diharapkanbahwasiklusIIakanberhasil.

Teknik Pengumpulan Data

Teknikpengumpulandatadigunakan

dua jenis yaitu data kualitatif dan data

yangbelumtercapai.Untukpencapaiantarget

belajarmaka guruharusmere�leksi dirinya,

apakah strategi yang digunakannya telah

sesuai atau tepat dengan materi yang akan

diajarkannya.Karenadenganadanyare�leksi

tadidiharapkangurumempunyai jalanyang

benardalampenyampaiannyadalamproses

pembelajaran.

Subjek, Waktu dan Tempat

Penelitian

Subjek penelitian ini adalah siswa

kelas VI Sekolah Dasar Negeri 016 Kundur.

Jumlahsiswa24orangterdiridari14laki-laki

dan 10 orang perempuan.Waktu penelitian

dimulai dari bulan Juni, Juli dan Agustus

Dimulai dengan menyusun proposal,

pelaksanaansiklusIdansiklusII,observasi,

danRe�leksisampaipembuatanlaporanhasil

penelitian.

Tempat penelitian adalah Sekolah

Dasar Negeri 016 Kundur. Lokasi sekolah

terletak di Tanjungbatu Kota Kecamatan

Kundur. Tempat tinggal siswa tidak berapa

jauh dari sekolah. Untuk menuju sekolah

dapatditempuhberjalankaki.Angkutankota

jugamelewatididepansekolah.

Prosedur Pelaksanaan Pembelajaran

Prosedur perbaikan pembelajaran

bertujuanuntukmeningkatkanhasil belajar

siswakhususnyamateri PKndenganmateri

menghargai nilai-nilai juang proses pe-

rumusan Pancasila sebagai Dasar Negara.

Meningkatkan akti�itas dalam belajar dan

mampumelakukankerjasamabertamateman

dan orang lain. Dapat mengetahui konsep

materi pembelajaran dan pada akhir pe-

lajaran, siswa telahmendapatkanhasilyang

diharapkan berdasarkan komptensi yang

telahdisusunguru.

Siklus I, pelaksanaan pada siklus

pertama yaitu membuat perencanaan

perbaikanpembelajaran.Alatyangdigunakan

dalam pelaksanaan tersebut berupa RPP

materi pembelajaran PKNmenghargai nilai-

nilai juang proses perumusan Pancasila

sebagai Dasar Negara dibantu oleh teman

sejawat.

Tahap Pelaksanaan, tahap pelak-

sanaandibagimenjaditigabagianyaitutahap

awal,tahapinti,dantahapakhir.a)Kegiatan

awal berisikan membaca doa, mengabsen

siswa, memberikan apersepsi, mem-

beritahukantujuanpelajaransetelahberakhir.

Kemudian guru memperlihatkan gambar-

gambar tokoh. Kegiatan awal, Tahap

pelaksanaan dalam kegiatan awal yaitu: 1)

Guru mengucapkan salam kepada semua

siswa, 2) Gurumengatur tempat duduk dan

pembagiankelompok,3)Membacadoayang

dipimpinolehketuakelas,4)Gurumengabsen

siswa, danmenanyakan bila ada siswa yang

tidakdatang,5)Gurumengadakanapersepsi

untuk melanjutkan proses pembelajaran, 6)

Gurumemberitahukantujuanpembelajaran.,

7) Guru memotivasi siswa agar serius

mengikuti prosespembelajaran; b)Kegiatan

Inti, pada kegiatan inti, telah disiapkan oleh

guru dan siswa naskah untuk materi

menghargai nilai-nilai juang dalam proses

perumusan Pancasila negara, 1) Penyajian

kelompoksatumempraktekkannaskahyang

telah dibuat sesuai dengan materi pem-

belajaran; 2) Kelompok lain mengadakan

pengamatanterhadapkelompokyangtampil;

3) Guru membimbing siswa dalam me-

nganalisis setiap kegiatan yang telah

ditampilkan; 4) Guru menyimpulkan pe-

lajaran, c)Kegiatan akhir: 1)Evaluasi untuk

melihatpendalamanterhadapnilai-nilaijuang

siswadalampokokbahasan;2)Tindaklanjut.

Page 81: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

80 81

Tahap Observasi atau Pengamatan,

Teman sejawat, pembimbing melakukan

observasi terhadap peneliti melakukan

kegiatanpembelajarandenganmenggunakan

metode bermain peran (role playing).

Pengamatan dilakukan mulai pelaksanaan

proses pembelajaran sampai berakhirnya

pembelajaran.

TahapRe�leksi,TahapRe�leksisetelah

diadakandiskusimasihbelumberhasilkarena

masih ada siswa yang mendapatkan nilai

kurang dari ketentuan kriteria ketuntasan

minimal mata pelajaran. Untuk itu perlu

diadakanperbaikanpembelajaranpadasiklus

II. Semua kejadian baik kelemahan dan

kelebihan proses pembelajaran pada siklus

berikutnya tidak akan terulang kembali dan

diharapkanbahwasiklusIIakanberhasil.

Siklus II, Pelaksanaan pada siklus I

telahdiadakandiskusidengantemansejawat,

pembimbing, telah disepakati bahwa

pelaksanaan pada siklus I belum men-

dapatkanhasilyangdiharapkankarenamasih

ada pelaksanaan guru yang masih belum

tercapai. Untuk itu pada siklus II akan

diperbaiki proses pembelajarannya. Pada

siklus II sebelum melaksanakan perbaikan

pembelajaran, guru menyusun rencana

perbaikan yaitu menyusun RPP, membuat

format guru dan siswa, menyusun naskah

pelajaran,membuattesatauevaluasiakhir.

PelaksanaanpadasiklusIIterbagimenjadi

tiga kegiatan dalam prosedur pembelajaran.

a) Kegiatan awal, tahap pelaksanaan dalam

kegiatan awal yaitu: 1) Guru mengucapkan

salamkepadasemuasiswa,2)Gurumengatur

tempat duduk dan pembagian kelompok, 3)

Membacadoayangdipimpinolehketuakelas,

4)Gurumengabsen siswa, danmenanyakan

bila ada siswa yang tidak datang, 5) Guru

mengadakan apersepsi untuk melanjutkan

proses pembelajaran, 6) Guru mem-

beritahukan bahwa tujuan pembelajaran, 6)

Gurumemotivasisiswaagarseriusmengikuti

proses pembelajaran. b) Kegiatan Inti, pada

kegiatan inti, telah disiapkan oleh guru dan

siswa naskah untuk dilakukan dalam

menjiwaimaterimenghargainilai-nilaijuang

dalam proses perumusan Pancasila bagi

negara: 1) Penyajian kelompok satu

mempraktekkan naskah yang telah dibuat

sesuai dengan materi pembelajaran; 2)

Kelompok lain mengadakan pengamatan

terhadap kelompok yang tampil; 3) Guru

membimbing siswa dalam menganalisis

setiap kegiatan yang telah ditambilkan; 4)

Guru menyimpulkan pelajaran; c) Kegiatan

akhir:1)Evaluasiuntukmelihatpendalaman

terhadapnilai-nilaijuangsiswadalampokok

bahasan;2)Tindaklanjut.

Tahap Observasi atau Pengamatan,

teman sejawat, pembimbing melakukan

observasi terhadap peneliti melakukan

kegiatanpembelajarandenganmenggunakan

metode bermain peran (role playing)

Pengamatan dilakukan mulai pelaksanaan

proses pembelajaran sampai berakhirnya

pembelajaran.

TahapRe�leksi,tahapRe�leksisetelah

diadakan diskusi masih belum berhasil

karenamasih ada siswa yangmendapatkan

nilai kurang dari ketentuan kriteria ke-

tuntasanminimalmata pelajaran. Untuk itu

perludiadakanperbaikanpembelajaranpada

siklusII.Semuakejadianbaikkelemahandan

kelebihan proses pembelajaran pada siklus

beikutnya tidak akan terulang kembali dan

diharapkanbahwasiklusIIakanberhasil.

Teknik Pengumpulan Data

Teknikpengumpulandatadigunakan

dua jenis yaitu data kualitatif dan data

yangbelumtercapai.Untukpencapaiantarget

belajarmaka guruharusmere�leksi dirinya,

apakah strategi yang digunakannya telah

sesuai atau tepat dengan materi yang akan

diajarkannya.Karenadenganadanyare�leksi

tadidiharapkangurumempunyai jalanyang

benardalampenyampaiannyadalamproses

pembelajaran.

Subjek, Waktu dan Tempat

Penelitian

Subjek penelitian ini adalah siswa

kelas VI Sekolah Dasar Negeri 016 Kundur.

Jumlahsiswa24orangterdiridari14laki-laki

dan 10 orang perempuan.Waktu penelitian

dimulai dari bulan Juni, Juli dan Agustus

Dimulai dengan menyusun proposal,

pelaksanaansiklusIdansiklusII,observasi,

danRe�leksisampaipembuatanlaporanhasil

penelitian.

Tempat penelitian adalah Sekolah

Dasar Negeri 016 Kundur. Lokasi sekolah

terletak di Tanjungbatu Kota Kecamatan

Kundur. Tempat tinggal siswa tidak berapa

jauh dari sekolah. Untuk menuju sekolah

dapatditempuhberjalankaki.Angkutankota

jugamelewatididepansekolah.

Prosedur Pelaksanaan Pembelajaran

Prosedur perbaikan pembelajaran

bertujuanuntukmeningkatkanhasil belajar

siswakhususnyamateri PKndenganmateri

menghargai nilai-nilai juang proses pe-

rumusan Pancasila sebagai Dasar Negara.

Meningkatkan akti�itas dalam belajar dan

mampumelakukankerjasamabertamateman

dan orang lain. Dapat mengetahui konsep

materi pembelajaran dan pada akhir pe-

lajaran, siswa telahmendapatkanhasilyang

diharapkan berdasarkan komptensi yang

telahdisusunguru.

Siklus I, pelaksanaan pada siklus

pertama yaitu membuat perencanaan

perbaikanpembelajaran.Alatyangdigunakan

dalam pelaksanaan tersebut berupa RPP

materi pembelajaran PKNmenghargai nilai-

nilai juang proses perumusan Pancasila

sebagai Dasar Negara dibantu oleh teman

sejawat.

Tahap Pelaksanaan, tahap pelak-

sanaandibagimenjaditigabagianyaitutahap

awal,tahapinti,dantahapakhir.a)Kegiatan

awal berisikan membaca doa, mengabsen

siswa, memberikan apersepsi, mem-

beritahukantujuanpelajaransetelahberakhir.

Kemudian guru memperlihatkan gambar-

gambar tokoh. Kegiatan awal, Tahap

pelaksanaan dalam kegiatan awal yaitu: 1)

Guru mengucapkan salam kepada semua

siswa, 2) Gurumengatur tempat duduk dan

pembagiankelompok,3)Membacadoayang

dipimpinolehketuakelas,4)Gurumengabsen

siswa, danmenanyakan bila ada siswa yang

tidakdatang,5)Gurumengadakanapersepsi

untuk melanjutkan proses pembelajaran, 6)

Gurumemberitahukantujuanpembelajaran.,

7) Guru memotivasi siswa agar serius

mengikuti prosespembelajaran; b)Kegiatan

Inti, pada kegiatan inti, telah disiapkan oleh

guru dan siswa naskah untuk materi

menghargai nilai-nilai juang dalam proses

perumusan Pancasila negara, 1) Penyajian

kelompoksatumempraktekkannaskahyang

telah dibuat sesuai dengan materi pem-

belajaran; 2) Kelompok lain mengadakan

pengamatanterhadapkelompokyangtampil;

3) Guru membimbing siswa dalam me-

nganalisis setiap kegiatan yang telah

ditampilkan; 4) Guru menyimpulkan pe-

lajaran, c)Kegiatan akhir: 1)Evaluasi untuk

melihatpendalamanterhadapnilai-nilaijuang

siswadalampokokbahasan;2)Tindaklanjut.

Page 82: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

82 83

kuantitatif. Data kualitatif yaitu proses

pembelajarandanrekamanaktivitassiswadi

dalam kelas. Rekaman tersebut berupa

kegiatan siswa dalam pembelajaran mulai

tingkat awal, inti sampai berakhirnya

pembelajaran. Sedangkan data kualitatif

berupahasilbelajaryaituulanganharian,nilai

akhir pembelajaran, aspek kegiatan belajar

siswaberupakeaktifandidalamkelas.

Teknik pengumpulan data dilakukan

dengan membuat aspek yang dinilai dalam

proses keaktifan siswa, bertujuan melihat

sejauh mana proses akti�itas siswa itu

berjalan.Pengamatantersebutdibantuteman

sejawatsetiapkalisikluspembelajaran.

Pengumpulan data dilakukanmulai

dariprasiklusyaitumemberikan teskepada

siswa tentang topik pelajaran. Kemudian

siklus I dan Siklus II.teman sejawat

mengumpulkandatatersebutuntukdijadikan

data proses pembelajaran yang masih

mendapa t p eny impangan maupun

kekurangan pada hasil yang masih rendah

untukperbaikanpembelajaranberikutnya.

Teknik Analisis Data

Analisis data dilakukan berdasarkan

proses pembelajaran mulai dari prasiklus,

siklus I dan Siklus II. Dalam hal perbaikan

pembelajaran, hasilnya diolah sehingga

mendapatkan hasil untuk penentuan

keberhasilanbelajarapakahtelahmengalami

peningkatanatautidak,baikdaripihakguru

maupun pihak siswa. Data diproses

menggunakan Deskripsi, kualitatif dan

kuantitatif.

HASILDANPEMBAHASAN

HasilPenelitian

Tabel 1 Distribusi Hasil Tes Prasiklus MataPelajaranPKnSiswaKelasVISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 60 TidakTuntas2 AdityaKurniawan L 75 Tuntas3 AinunJariah P 75 Tuntas4 Aisyah P 60 TidakTuntas5 AntonDinata L 70 Tuntas6 DianaTasya

P

75

Tuntas7 DiyanLestari

P

75

Tuntas8 Gunawan L

65

TidakTuntas9 HendySaputra

L

77

Tuntas10 M.Aqsal L

75

Tuntas11 M.Firmansyah

L

60

TidakTuntas12 M.Izbal L

60

TidakTuntas13 M.Johansyah

L

75

Tuntas14 Nanda P

60

TidakTuntas15 Melliani P

60

TidakTuntas16 NurhayaniSaputri

P

70

Tuntas17 PutriWidya

P

60

TidakTuntas18 RikiFriando

L

60

TidakTuntas

19 RiskiFanita

P

70

Tuntas20 RismaFatmawati P 76 Tuntas21 Risnasari P

60

TidakTuntas

22 R.Nurannisa

P

70

Tuntas

23 SitiAisyah P

70

Tuntas24 Yuliana P

70

TuntasJumlahnilai 1628Rata-rataNilai 67,83JumlahSiswa 24KKM 70Tuntas 14 58,33%TidakTuntas 10 41,67%NilaiTerendah 60NilaiTertinggi 77

Sumber data: olahan tes prasiklus

2016

Sebelum pelaksanaan dimulai, guru

dan teman sejawat telah mengadakan

observasi tentang kegiatan yang dilakukan.

Untuk perbaikan perbelajaran diadakan tes

awalatautesprasiklus.Setelahdijalankantes

maka has i lnya adalah jumlah n i la i

keseluruhan1628danrata-ratanilaiperkelas

67,83. Siswayang tuntas sebanyak14orang

(58,33)sedangkanyangtidaktuntassebanyak

10 orang (41,66 %), nilai terendah 60,

tertinggi 77, sedangkan standar kriteria

ketuntasan minimal 70. Dari hasil tersebut,

guru menyusun rencana perbaikan pada

siklus I. Hasil yang diperoleh dapar dilihat

padaTabel2.

Tabel 2 Distribusi Hasil Tes Siklus II MataPelajaran PKn Siswa Kelas VISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 65 TidakTuntas

2 AdityaKurniawan L 75 Tuntas3 AinunJariah P 75 Tuntas4 Aisyah P 70 Tuntas5 AntonDinata L 70 Tuntas6 DianaTasya

P

75

Tuntas7 DiyanLestari

P

76

Tuntas8 Gunawan L

70

Tuntas9 HendySaputra

L

77

Tuntas10 M.Aqsal L

76

Tuntas11 M.Firmansyah

L

65

TidakTuntas12 M.Izbal L

60

TidakTuntas13 M.Johansyah

L

76

Tuntas14 Nanda P

70

Tuntas

15 Melliani P 63 TidakTuntas16 NurhayaniSaputri P 70 Tuntas17 PutriWidya

P

65

TidakTuntas

18 RikiFriando

L

68

TidakTuntas19 RiskiFanita

P

73

Tuntas20 RismaFatmawati

P

78

Tuntas21 Risnasari P

65

TidakTuntas22 R.Nurannisa

P

70

Tuntas23 SitiAisyah P

75

Tuntas24 Yuliana P

70

TuntasJumlahnilai 1697Rata-rataNilai 70,71JumlahSiswa 24KKM 70Tuntas 17 70,83%TidakTuntas 7 29,17%NilaiTerendah 65NilaiTertinggi 78

Sumberdata:olahantesprasiklus2016

HasilbelajarsiswapadasiklusIdapat

dilihatpadatabel2diatas, jumlahnilai1697

danrata-rata71,79dengan jumlahsiswa24

orang.Yangtuntassebanyak17(70,83%)dan

tidak tuntas sebanyak7orang (29,17).Nilai

terendah 60 dan nilai tertinggi 78. Hasil

tersebut belum mencapai target yang

diinginkan,makadilanjutkanlagikesiklusII.

Tabel 3 Distribusi Hasil Tes Siklus II MataPelajaran PKn Siswa Kelas VISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 76 Tuntas2 AdityaKurniawan L 80 Tuntas3 AinunJariah P 80 Tuntas4 Aisyah P 75 Tuntas5 AntonDinata L 73 Tuntas6 DianaTasya P 83 Tuntas7 DiyanLestari

P

80

Tuntas8 Gunawan L

77

Tuntas9 HendySaputra

L

80

Tuntas10 M.Aqsal L

83

Tuntas11 M.Firmansyah

L

78

Tuntas12 M.Izbal L

75

Tuntas13 M.Johansyah

L

80

Tuntas14 Nanda P

75

Tuntas

15 Melliani P

78

Tuntas16 NurhayaniSaputri P 85 Tuntas17 PutriWidya P

80

Tuntas

18 RikiFriando

L

80

Tuntas19 RiskiFanita P

85

Tuntas20 RismaFatmawati

P

85

Tuntas21 Risnasari P

78

Tuntas22 R.Nurannisa

P

80

Tuntas23 SitiAisyah P

85

Tuntas24 Yuliana P

80

TuntasJumlahnilai 3325Rata-rataNilai 79,63JumlahSiswa 24KKM 70Tuntas 24 100%TidakTuntas 0NilaiTerendah 73NilaiTertinggi 85

Sumber data: olahan tes prasiklus

2016

Darihasilpelaksanaanperbaikandari

prasiklussampaikesiklusIpeningkatanhasil

belajarsiswameningkat.SiklusIIjumlahnilai

3325danrata-ratakelas79,63dari24orang

dengankriteriaketuntasanminimal70.Dari

hasiltersebutseluruhsiswatelahmemahami

isi materi yang diajarkan guru dan nilai

terendah73dantertinggi85.

Dari ketiga proses tes, dapat di-

simpulkan bahwa rata-rata persentasi

ketuntasan prasiklus14 (41,66%), siklus I

menjadi17 (70,83%)danssiklusIImenjadi

24orang(100%).

Untuk mengetahui tingkat pe-

nguasaan siswa dalam belajar PKn dengan

materimenghargai nilai-nilai juang dalam

proses perumusan sebagai Negara Pancasila

sebagaiberikut.

Tabel4.DistribusiRentangdanKriteriaNilaiTes Prasiklus Mata Pelajaran PKnSiswaKelasVISekolahDasar Negeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 58 Tinggi

3 69– 78 Cukup 14 58,33% Tuntas4 59– 68 Rendah 10 41,67% Tidaktuntas5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumberdata:olahantesprasiklus2016

Hasiltessiswapadaprasiklus69–78

kriteria cukup terdapat sebanyak 14 orang

(58.33%)danrentang59–68sebanyak10

orang (41,67%). Tingkat penguasaan siswa

terletakpadarentangdankriteriacukup.

SelanjutnyahasiltespadasiklusIdapatdilihat

padaTabel5berikut:

Page 83: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

82 83

kuantitatif. Data kualitatif yaitu proses

pembelajarandanrekamanaktivitassiswadi

dalam kelas. Rekaman tersebut berupa

kegiatan siswa dalam pembelajaran mulai

tingkat awal, inti sampai berakhirnya

pembelajaran. Sedangkan data kualitatif

berupahasilbelajaryaituulanganharian,nilai

akhir pembelajaran, aspek kegiatan belajar

siswaberupakeaktifandidalamkelas.

Teknik pengumpulan data dilakukan

dengan membuat aspek yang dinilai dalam

proses keaktifan siswa, bertujuan melihat

sejauh mana proses akti�itas siswa itu

berjalan.Pengamatantersebutdibantuteman

sejawatsetiapkalisikluspembelajaran.

Pengumpulan data dilakukanmulai

dariprasiklusyaitumemberikan teskepada

siswa tentang topik pelajaran. Kemudian

siklus I dan Siklus II.teman sejawat

mengumpulkandatatersebutuntukdijadikan

data proses pembelajaran yang masih

mendapa t p eny impangan maupun

kekurangan pada hasil yang masih rendah

untukperbaikanpembelajaranberikutnya.

Teknik Analisis Data

Analisis data dilakukan berdasarkan

proses pembelajaran mulai dari prasiklus,

siklus I dan Siklus II. Dalam hal perbaikan

pembelajaran, hasilnya diolah sehingga

mendapatkan hasil untuk penentuan

keberhasilanbelajarapakahtelahmengalami

peningkatanatautidak,baikdaripihakguru

maupun pihak siswa. Data diproses

menggunakan Deskripsi, kualitatif dan

kuantitatif.

HASILDANPEMBAHASAN

HasilPenelitian

Tabel 1 Distribusi Hasil Tes Prasiklus MataPelajaranPKnSiswaKelasVISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 60 TidakTuntas2 AdityaKurniawan L 75 Tuntas3 AinunJariah P 75 Tuntas4 Aisyah P 60 TidakTuntas5 AntonDinata L 70 Tuntas6 DianaTasya

P

75

Tuntas7 DiyanLestari

P

75

Tuntas8 Gunawan L

65

TidakTuntas9 HendySaputra

L

77

Tuntas10 M.Aqsal L

75

Tuntas11 M.Firmansyah

L

60

TidakTuntas12 M.Izbal L

60

TidakTuntas13 M.Johansyah

L

75

Tuntas14 Nanda P

60

TidakTuntas15 Melliani P

60

TidakTuntas16 NurhayaniSaputri

P

70

Tuntas17 PutriWidya

P

60

TidakTuntas18 RikiFriando

L

60

TidakTuntas

19 RiskiFanita

P

70

Tuntas20 RismaFatmawati P 76 Tuntas21 Risnasari P

60

TidakTuntas

22 R.Nurannisa

P

70

Tuntas

23 SitiAisyah P

70

Tuntas24 Yuliana P

70

TuntasJumlahnilai 1628Rata-rataNilai 67,83JumlahSiswa 24KKM 70Tuntas 14 58,33%TidakTuntas 10 41,67%NilaiTerendah 60NilaiTertinggi 77

Sumber data: olahan tes prasiklus

2016

Sebelum pelaksanaan dimulai, guru

dan teman sejawat telah mengadakan

observasi tentang kegiatan yang dilakukan.

Untuk perbaikan perbelajaran diadakan tes

awalatautesprasiklus.Setelahdijalankantes

maka has i lnya adalah jumlah n i la i

keseluruhan1628danrata-ratanilaiperkelas

67,83. Siswayang tuntas sebanyak14orang

(58,33)sedangkanyangtidaktuntassebanyak

10 orang (41,66 %), nilai terendah 60,

tertinggi 77, sedangkan standar kriteria

ketuntasan minimal 70. Dari hasil tersebut,

guru menyusun rencana perbaikan pada

siklus I. Hasil yang diperoleh dapar dilihat

padaTabel2.

Tabel 2 Distribusi Hasil Tes Siklus II MataPelajaran PKn Siswa Kelas VISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 65 TidakTuntas

2 AdityaKurniawan L 75 Tuntas3 AinunJariah P 75 Tuntas4 Aisyah P 70 Tuntas5 AntonDinata L 70 Tuntas6 DianaTasya

P

75

Tuntas7 DiyanLestari

P

76

Tuntas8 Gunawan L

70

Tuntas9 HendySaputra

L

77

Tuntas10 M.Aqsal L

76

Tuntas11 M.Firmansyah

L

65

TidakTuntas12 M.Izbal L

60

TidakTuntas13 M.Johansyah

L

76

Tuntas14 Nanda P

70

Tuntas

15 Melliani P 63 TidakTuntas16 NurhayaniSaputri P 70 Tuntas17 PutriWidya

P

65

TidakTuntas

18 RikiFriando

L

68

TidakTuntas19 RiskiFanita

P

73

Tuntas20 RismaFatmawati

P

78

Tuntas21 Risnasari P

65

TidakTuntas22 R.Nurannisa

P

70

Tuntas23 SitiAisyah P

75

Tuntas24 Yuliana P

70

TuntasJumlahnilai 1697Rata-rataNilai 70,71JumlahSiswa 24KKM 70Tuntas 17 70,83%TidakTuntas 7 29,17%NilaiTerendah 65NilaiTertinggi 78

Sumberdata:olahantesprasiklus2016

HasilbelajarsiswapadasiklusIdapat

dilihatpadatabel2diatas, jumlahnilai1697

danrata-rata71,79dengan jumlahsiswa24

orang.Yangtuntassebanyak17(70,83%)dan

tidak tuntas sebanyak7orang (29,17).Nilai

terendah 60 dan nilai tertinggi 78. Hasil

tersebut belum mencapai target yang

diinginkan,makadilanjutkanlagikesiklusII.

Tabel 3 Distribusi Hasil Tes Siklus II MataPelajaran PKn Siswa Kelas VISekolahDasarNegeri016Kundur

No NamaJenis

KelaminNilai Keterangan

1 AbdulRahman L 76 Tuntas2 AdityaKurniawan L 80 Tuntas3 AinunJariah P 80 Tuntas4 Aisyah P 75 Tuntas5 AntonDinata L 73 Tuntas6 DianaTasya P 83 Tuntas7 DiyanLestari

P

80

Tuntas8 Gunawan L

77

Tuntas9 HendySaputra

L

80

Tuntas10 M.Aqsal L

83

Tuntas11 M.Firmansyah

L

78

Tuntas12 M.Izbal L

75

Tuntas13 M.Johansyah

L

80

Tuntas14 Nanda P

75

Tuntas

15 Melliani P

78

Tuntas16 NurhayaniSaputri P 85 Tuntas17 PutriWidya P

80

Tuntas

18 RikiFriando

L

80

Tuntas19 RiskiFanita P

85

Tuntas20 RismaFatmawati

P

85

Tuntas21 Risnasari P

78

Tuntas22 R.Nurannisa

P

80

Tuntas23 SitiAisyah P

85

Tuntas24 Yuliana P

80

TuntasJumlahnilai 3325Rata-rataNilai 79,63JumlahSiswa 24KKM 70Tuntas 24 100%TidakTuntas 0NilaiTerendah 73NilaiTertinggi 85

Sumber data: olahan tes prasiklus

2016

Darihasilpelaksanaanperbaikandari

prasiklussampaikesiklusIpeningkatanhasil

belajarsiswameningkat.SiklusIIjumlahnilai

3325danrata-ratakelas79,63dari24orang

dengankriteriaketuntasanminimal70.Dari

hasiltersebutseluruhsiswatelahmemahami

isi materi yang diajarkan guru dan nilai

terendah73dantertinggi85.

Dari ketiga proses tes, dapat di-

simpulkan bahwa rata-rata persentasi

ketuntasan prasiklus14 (41,66%), siklus I

menjadi17 (70,83%)danssiklusIImenjadi

24orang(100%).

Untuk mengetahui tingkat pe-

nguasaan siswa dalam belajar PKn dengan

materimenghargai nilai-nilai juang dalam

proses perumusan sebagai Negara Pancasila

sebagaiberikut.

Tabel4.DistribusiRentangdanKriteriaNilaiTes Prasiklus Mata Pelajaran PKnSiswaKelasVISekolahDasar Negeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 58 Tinggi

3 69– 78 Cukup 14 58,33% Tuntas4 59– 68 Rendah 10 41,67% Tidaktuntas5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumberdata:olahantesprasiklus2016

Hasiltessiswapadaprasiklus69–78

kriteria cukup terdapat sebanyak 14 orang

(58.33%)danrentang59–68sebanyak10

orang (41,67%). Tingkat penguasaan siswa

terletakpadarentangdankriteriacukup.

SelanjutnyahasiltespadasiklusIdapatdilihat

padaTabel5berikut:

Page 84: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

84 85

Tabel5.DistribusiRentangdanKriteriaNilaiTesSiklusIMataPelajaranPKnSiswaKelasVI SekolahDasar Negeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 58 Tinggi

3 69– 78 Cukup 17 70,83% Tuntas4 59– 68 Rendah 7 29,17% TidakTuntas5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumberdata:olahantessiklusI2016

Hasil tessiswapadasiklus I69–78

kriteria cukup terdapat sebanyak 17 orang

(70,83%) dan rentang 59 – 68 sebanyak 7

orang (29,17%).Tingkat penguasaan siswa

terletakpadarentangdankriteriacukup.

Jika dilihat perolehan nilai dari

prasikluskesiklus1tidakbanyakperubahan,

makadilanjutkanpadasiklusII.

Tabel6.DistribusiRentangdanKriteriaNilaiTesSiklusIIMataPelajaranPKnSiswaKelasVISekolahDasarNegeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 88 Tinggi

15

62,50%

Tuntas

3 69– 78 Cukup 9 37,50% Tuntas4 59– 68 Rendah 5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumber data: olahan tes siklus II

2016

Hasil belajar yang diperoleh siswa

pada siklus II tampak peningkatannya

berdasarkan rentang nilai 69 – 78 dengan

kriteria cukup sebanyak 9 orang (37,50%)

danrentang79–88sebanyak15orang(62,50

%).JadihasilbelajarpadasiklusIIperingkat

belajarsiswapadatingkattinggi.

Pembahasan

Dalam pelaksanaan pembelajaran

sebelumnya, guru selalu menggunakan

metode ceramah, tanya jawab dan tugas.

Pengetahuan siswa hanya pada tahap

menerima materi berdasarkan dari

penjelasan guru, sedangkan siswa sendiri

tidakmampumemahamikonsepyangharus

mereka pelajari. Dengan adanya metode

bermain peran, siswamampumenanamkan

konsep pada dirinya sesuai dengan

kompetensiyangtelahdibuatolehgurudalam

prosespembelajaran.

Hasil tes pada siklus I yang tuntas

79,83%menunjukkankenaikandarihasiltes

prasiklus yaitu 58,33. Perubahan tersebut

belummenunjukkannilaiketuntasanminimal

70. Namun jumlah nilai dari hasil tes

prasiklus1628denganrata-rata 67,83,pada

siklus I meningkat jumlah nilai 1697 dan

ratar-rata nilai 70,71. Setelah dilakukan

perbaikanpembelajaranpadasiklusIIjumlah

nilai 3325 dan rata-rata 70,63 semua siswa

telahmencapai kriteria ketuntasanminimal

lulus100%

SIMPULAN DAN SARAN

Simpulan

Berdasarkan data dan analisis data

yang diperoleh peneliti dalam pelaksanaan

pembelajaran penggunaan metode bermain

peran (role playing) dalam meningkatkan

pemahamankonseptentangnilai-nilai juang

dalam proses perumusan pancasila sebagai

dasar negara kelas VI Sekolah Dasar Negeri

016 Kundur dapat disimpulkan bahwa: 1)

Penerapan metode bermain peran (role

playing) dapat digunakan dalam materi

pelajaranPKnkhususnyamaterimenghargai

nilai-nilai juang dalam proses perumusan

pancasila sebagai dasar negara; 2) Metode

bermain peran (role playing) dapat

meningkatkan hasil belajar siswa. Dapat

dibuktikan bahwa hasil belajar prasiklus

siswamendapatnilaituntas58,33%;siklusI

menjadi 70,83 %, dan siklus II meningkat

menjadi 100 %. Hasil nilai berdasarkan

rentangdankriterianilaiyaitu79–88dengan

tingkatkriteriatinggi.

Saran

Dari Simpulan di atas, ada beberapa

saran yang perlu diperhatikan oleh semua

pihak terutama guru, siswa, kepala sekolah

danpihakterkaityakni:1)Guru,hendaknya

dapat menggunakan metode yang mampu

dihayati siswa, sehingga mereka dapat

memahami konsep materi pelajaran dalam

metodebermainperan(roleplaying) dalam

proses pembelajaran; 2) Siswa, hendaknya

siapdanmampuuntuk memacudiridalam

menghayati peran yang dimainkan sesuai

dengan materi pelajaran agar konsep yang

diberikandapatlamadihayatidalamjiwanya;

3)Kepalasekolah,hendaknyamenyampaikan

kepada guru-guru di sekolahnya dalam

menggunakan metodeBermain Peran (Role

Playing)pokokbahasanyanglain,sertadapat

memberikanbimbingandalamKegiatanKerja

Guru (KKG) dalam pemilihan metode yang

cocokdenganmateripelajaran.

DAFTARPUSTAKA

Adi Suryanto, dkk. Evaluasi Pembelajaran diSD.Jakarta.UniversitasTerbuka.

Aunurahman2012.BelajardanPembelajaran.Jakarta.Alfabeta.

BennyN.Pribadi.2011.RudiSusilanadanCepiR i v a n a . 2 0 0 9 . M e d i aPembelajaran.Bandung.CP WacanaPrima.

Dariman. 2013. PLPG Kelompok Guru KelasMadrasah Ibtidaiyah.Semarang. IAINWalisongo.

Dimyati dan Mudjiono: 2006. Belajar danPembelajaran.Jakarta.PenerbitRinekaCipta

Mulyadi. H. 1991. Psikologi Pendidikan.Malang. Biro Ilmiah FEIAIN SunanAmpel.

Roestiyah.N.K. 2008.Strategi BelajarMengajar. Jakarta. Penerbit Rineka

Cipta.

RudiSusilanadanCecepRiyana.2009.MediaPembelajaran. Bandung. CV. WacanaPrima.

Sardiman A.M, 2005. Interaksi dan MotivasiBelajar Mengajar. Jakarta. PT RajaGra�indoPersada

Slameto.1995.BelajardanFaktor-FaktoryangMedmpengaruhinya. Jakarta. RinekaCipta

Suhardjono.2007. PenelitianTindakanKelas.Jakarta.PenerbitBumiAksara.

Wah i dmu r n i d k k , 2 0 1 0 , E v a l u a s iPembelajaran Kompetensi danPraktek,NuhaLiteraYogyakarta.

Wardani.IGAK. 2012. Penelitian TindakanKelas.Jakarta.UniversitasTerbuka.

W. Gulo. 2011. Strategi Belajar Mengajar.Jakarta.Grasindo.

Page 85: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

84 85

Tabel5.DistribusiRentangdanKriteriaNilaiTesSiklusIMataPelajaranPKnSiswaKelasVI SekolahDasar Negeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 58 Tinggi

3 69– 78 Cukup 17 70,83% Tuntas4 59– 68 Rendah 7 29,17% TidakTuntas5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumberdata:olahantessiklusI2016

Hasil tessiswapadasiklus I69–78

kriteria cukup terdapat sebanyak 17 orang

(70,83%) dan rentang 59 – 68 sebanyak 7

orang (29,17%).Tingkat penguasaan siswa

terletakpadarentangdankriteriacukup.

Jika dilihat perolehan nilai dari

prasikluskesiklus1tidakbanyakperubahan,

makadilanjutkanpadasiklusII.

Tabel6.DistribusiRentangdanKriteriaNilaiTesSiklusIIMataPelajaranPKnSiswaKelasVISekolahDasarNegeri016Kundur

NoRentangNilai

Kriteriapenilaian

Prekuensi Persentase Keterangan

1 89– 100 Sangattinggi

2 79– 88 Tinggi

15

62,50%

Tuntas

3 69– 78 Cukup 9 37,50% Tuntas4 59– 68 Rendah 5 10- 58 SangatRendah

JumlahSiswa 24KKM 70

Sumber data: olahan tes siklus II

2016

Hasil belajar yang diperoleh siswa

pada siklus II tampak peningkatannya

berdasarkan rentang nilai 69 – 78 dengan

kriteria cukup sebanyak 9 orang (37,50%)

danrentang79–88sebanyak15orang(62,50

%).JadihasilbelajarpadasiklusIIperingkat

belajarsiswapadatingkattinggi.

Pembahasan

Dalam pelaksanaan pembelajaran

sebelumnya, guru selalu menggunakan

metode ceramah, tanya jawab dan tugas.

Pengetahuan siswa hanya pada tahap

menerima materi berdasarkan dari

penjelasan guru, sedangkan siswa sendiri

tidakmampumemahamikonsepyangharus

mereka pelajari. Dengan adanya metode

bermain peran, siswamampumenanamkan

konsep pada dirinya sesuai dengan

kompetensiyangtelahdibuatolehgurudalam

prosespembelajaran.

Hasil tes pada siklus I yang tuntas

79,83%menunjukkankenaikandarihasiltes

prasiklus yaitu 58,33. Perubahan tersebut

belummenunjukkannilaiketuntasanminimal

70. Namun jumlah nilai dari hasil tes

prasiklus1628denganrata-rata 67,83,pada

siklus I meningkat jumlah nilai 1697 dan

ratar-rata nilai 70,71. Setelah dilakukan

perbaikanpembelajaranpadasiklusIIjumlah

nilai 3325 dan rata-rata 70,63 semua siswa

telahmencapai kriteria ketuntasanminimal

lulus100%

SIMPULAN DAN SARAN

Simpulan

Berdasarkan data dan analisis data

yang diperoleh peneliti dalam pelaksanaan

pembelajaran penggunaan metode bermain

peran (role playing) dalam meningkatkan

pemahamankonseptentangnilai-nilai juang

dalam proses perumusan pancasila sebagai

dasar negara kelas VI Sekolah Dasar Negeri

016 Kundur dapat disimpulkan bahwa: 1)

Penerapan metode bermain peran (role

playing) dapat digunakan dalam materi

pelajaranPKnkhususnyamaterimenghargai

nilai-nilai juang dalam proses perumusan

pancasila sebagai dasar negara; 2) Metode

bermain peran (role playing) dapat

meningkatkan hasil belajar siswa. Dapat

dibuktikan bahwa hasil belajar prasiklus

siswamendapatnilaituntas58,33%;siklusI

menjadi 70,83 %, dan siklus II meningkat

menjadi 100 %. Hasil nilai berdasarkan

rentangdankriterianilaiyaitu79–88dengan

tingkatkriteriatinggi.

Saran

Dari Simpulan di atas, ada beberapa

saran yang perlu diperhatikan oleh semua

pihak terutama guru, siswa, kepala sekolah

danpihakterkaityakni:1)Guru,hendaknya

dapat menggunakan metode yang mampu

dihayati siswa, sehingga mereka dapat

memahami konsep materi pelajaran dalam

metodebermainperan(roleplaying) dalam

proses pembelajaran; 2) Siswa, hendaknya

siapdanmampuuntuk memacudiridalam

menghayati peran yang dimainkan sesuai

dengan materi pelajaran agar konsep yang

diberikandapatlamadihayatidalamjiwanya;

3)Kepalasekolah,hendaknyamenyampaikan

kepada guru-guru di sekolahnya dalam

menggunakan metodeBermain Peran (Role

Playing)pokokbahasanyanglain,sertadapat

memberikanbimbingandalamKegiatanKerja

Guru (KKG) dalam pemilihan metode yang

cocokdenganmateripelajaran.

DAFTARPUSTAKA

Adi Suryanto, dkk. Evaluasi Pembelajaran diSD.Jakarta.UniversitasTerbuka.

Aunurahman2012.BelajardanPembelajaran.Jakarta.Alfabeta.

BennyN.Pribadi.2011.RudiSusilanadanCepiR i v a n a . 2 0 0 9 . M e d i aPembelajaran.Bandung.CP WacanaPrima.

Dariman. 2013. PLPG Kelompok Guru KelasMadrasah Ibtidaiyah.Semarang. IAINWalisongo.

Dimyati dan Mudjiono: 2006. Belajar danPembelajaran.Jakarta.PenerbitRinekaCipta

Mulyadi. H. 1991. Psikologi Pendidikan.Malang. Biro Ilmiah FEIAIN SunanAmpel.

Roestiyah.N.K. 2008.Strategi BelajarMengajar. Jakarta. Penerbit Rineka

Cipta.

RudiSusilanadanCecepRiyana.2009.MediaPembelajaran. Bandung. CV. WacanaPrima.

Sardiman A.M, 2005. Interaksi dan MotivasiBelajar Mengajar. Jakarta. PT RajaGra�indoPersada

Slameto.1995.BelajardanFaktor-FaktoryangMedmpengaruhinya. Jakarta. RinekaCipta

Suhardjono.2007. PenelitianTindakanKelas.Jakarta.PenerbitBumiAksara.

Wah i dmu r n i d k k , 2 0 1 0 , E v a l u a s iPembelajaran Kompetensi danPraktek,NuhaLiteraYogyakarta.

Wardani.IGAK. 2012. Penelitian TindakanKelas.Jakarta.UniversitasTerbuka.

W. Gulo. 2011. Strategi Belajar Mengajar.Jakarta.Grasindo.

Page 86: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

86 87

Akibatnya kepala sekolah sebagai pembuat

kebijakan di sekolah tidak dapat meng-

evaluasi kinerja guru secara akademik.

Kinerjayangdapatdilihatolehkepalasekolah

hanyalah kehadiran tatap muka, tanpa

mengetahui apakahkemampuangurudalam

mengelolapembelajaransudahsesuaidengan

harapan atau belum, atau sudahkah kom-

petensidasaryangharusdikuasaiolehsiswa

terkuasaidenganbenar.Hasilpengamatandi

tahun pelajaran 2015/2016 di SDN 001

Tarempadidapatkandatasebagaiberikut:1)

hanya60%guruyangmenyusunsilabusdan

RPP,2)Secarakualitas,silabusdanRPPyang

baikbarumencapai angka30%dari silabus

danRPPyangdibuatolehguru.

Kompetensi Guru

Berpedomankepadatujuanpendidikan

yakni meningkatkan kualitas sumber daya

manusia.Dalamusahameningkatkankualitas

sumber daya pendidikan, guru merupakan

komponensumberdayamanusiayangharus

dibina dan dikembangkan terus-menerus.

Potensi sumber daya guru itu perlu terus

tumbuh dan berkembang agar dapat

melakukanfungsinyasecarapotensial.Selain

itu pengaruh perubahan yang serba cepat

menuntut guru-guru untuk terus-menerus

belajar menyesuaikan diri dengan per-

kembanganilmupengetahuandanteknologi

sertamobilitasmasyarakat.

Masyarakat mempercayai, mengakui

dan menyerahkan kepada guru untuk

mendidik tunas-tunasmuda danmembantu

mengembangkan potens inya secara

professional. Kepercayaan, keyakinan, dan

penerimaan ini merupakan substansi dari

pengakuanmasyarakatterhadapprofesiguru.

Implikasi dari pengakuan tersebut meng-

haruskan guru memiliki kualitas yang

memadai.Tidakhanyapadatatarannormatif

saja namun mampu mengembangkan

kompetensi yang dimiliki, baik kompetensi

personal , professional , maupun ke-

masyarakatan dalam selubung aktualisasi

kebijakanpendidikan.

Profesionalismemenjadituntutandari

setiap pekerjaan. Apalagi profesi guru yang

sehari-hari menangani benda hidup

berupa siswa dengan berbagai

karakteristikyangmasing-masingtidaksama.

Pekerjaaansebagaigurumenjadilebihberat

ketikamenyangkut peningkatan kemam-

puan anak didiknya, sedangkankemam-

puandirinyamengalamistagnasi.Guruyang

profesional adalah mereka yang memiliki

kemampuan profesional dengan berbagai

kapasitasnya sebagai pendidik. Studi yang

dilakukan oleh Ace Suryani menunjukkan

bahwa Guru yang bermutu dapat diukur

dengan lima indikator, yaitu: pertama,

kemampuan profesional (professional

capacity), sebagaimana terukur dari ijazah,

jenjang pendidikan, jabatan dan golongan,

serta pelatihan. Kedua, upaya profesional

(professional efforts), sebagaimana terukur

dari kegiatan mengajar, pengabdian dan

penelitian. Ketiga, waktu yangdicurahkan

untuk kegiatan profesional (teacher's time),

sebagaimana terukur dari masa jabatan,

pengalaman mengajar serta lainnya.

Keempat, kesesuaian antara keahlian dan

pekerjaannya(linkandmatch),sebagaimana

terukur dari mata pelajaran yang diampu,

apakah telah sesuaidengan spesialisasinya

atautidak,sertakelima,tingkatkesejahteraan

(prosperiousity) sebagaimana terukur dari

upah, honor atau penghasilan rutinnya.

Tingkat kesejahteraan yang rendah bisa

mendorong seorang pendidik untuk

melakukan kerja sambilan, dan bilamana

kerjasambilaninisukses,bisajadiprofesi

UPAYAPENINGKATANKOMPETENSIGURUDALAMMENYUSUNSILABUSDANRPPMELALUI SUPERVISIAKADEMIKYANGBERKELANJUTAN

DISDNEGERI001TAREMPA

Riawati*

Abstrak: Penelitian ini bertujuan untuk mengetahui kopetensi guru dalam menyusun perangkatpembelajaran.JenisPenelitianiniPenelitianTindakanSekolah(PTS).PopulasipenelitianiniadalahseluruhguruSDnegeri001Tarempa.Prosespenelitiandengantindakanyangdilaluidengansiklus,yangteridiridariduasiklus.SupervisiakademiksecaraberkelanjutanterbuktisecarailmiahdapatmeningkatkankompetensigurudalammenyusunsilabusdanRencanaPelaksanaanPembelajaran(RPP)diSDNegeri001TarempaKepulauanAnambas,Hasilpenelitianpadasiklus Imeningkatnya jumlahsilabusyangdibuatguruyangberkualitasbaikdari31%menjadi83%setelahsupervisiakademik.SelainitujumlahRencanaPelaksanaanPembelajaran(RPP)yangberkualitasbaikjugameningkatpadasilkusIIdari38%menjadi89%.

KataKunci:KompetensiGuru,SupervisiAkademik

PENDAHULUAN

Peran pendidikan sangat menentukan

perkembangandanperwujudandiriindividu,

terutama bagi pembangunan bangsa dan

negara. Tujuan pendidikan pada umumnya

adalah menyediakan lingkungan yang

memungkinkanpesertadidikuntukmengem-

bangkan bakat dan kemampuannya secara

optimal. Salah satu bantuan yang diberikan

pendidikan agar terjadi proses yang meng-

hasilkan ilmu pengetahuan, penguasaan,

kemahiran, tabiat, serta pembentukan sikap

dankeyakinanpesertadidikuntukmengem-

bangkan bakat dan kemampuannya melalui

prosespembelajaran.

Pembelajarandiartikansebagaiproses

interaksipesertadidikdenganpendidikdan

sumberbelajarpadasuatulingkunganbelajar

(UUNo20Tahun2003).Dewasaini,konteks

pembelajaran diarahkan dalam pendekatan

pembelajaran tematik yang menggunakan

tema untuk mengaitkan beberapa mata

pelajaran dan materi sehingga dapat

memberikan pengalaman yang bermakna

padapesertadidik.

Pembelajaran mengandung tiga hal

pokok yakni perencanaan, pelaksanaan dan

evaluasi.Perencanaan program berfungsi

untuk memberikan arah pelaksanaan

pembelajaransehinggamenjaditerarahdan

e�isien.Salahsatubagiandariperencanaan

pembelajaranyangsangatpentingdibuatoleh

guru sebagaipengarahpembelajaranadalah

silabus dan Rencana Pelaksanaan Pem-

belajaran(RPP).Silabus memberikan arah

tentang apa saja yang harus dicapai guna

menggapai tujuan pembelajaran dan cara

seperti apa yang akan digunakan. Selain itu

silabusjugamemuatteknikpenilaianseperti

sejauh mana keberhasilan pembelajaran.

Rencana Pelaksanaan Pembelajaran (RPP)

adalah instrumen perencanaan yang lebih

spesi�ik dari silabus. Rencana Pelaksanaan

Pembelajaran (RPP) ini dibuat untuk

memandugurudalammengajaragartidak

melebar jauh dari tujuan pembelajaran.

Dengan melihat pentingnya penyusunan

perencanaan pembelajaran ini , guru

semestinya tidak mengajar tanpa adanya

rencana. Namun dapat disayangkan karena

perencanaan pembelajaran tidak dapat

diukur oleh kepala sekolah sebab hanya

direncanakan dalam pikiran sang guru saja.

Page 87: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

86 87

Akibatnya kepala sekolah sebagai pembuat

kebijakan di sekolah tidak dapat meng-

evaluasi kinerja guru secara akademik.

Kinerjayangdapatdilihatolehkepalasekolah

hanyalah kehadiran tatap muka, tanpa

mengetahui apakahkemampuangurudalam

mengelolapembelajaransudahsesuaidengan

harapan atau belum, atau sudahkah kom-

petensidasaryangharusdikuasaiolehsiswa

terkuasaidenganbenar.Hasilpengamatandi

tahun pelajaran 2015/2016 di SDN 001

Tarempadidapatkandatasebagaiberikut:1)

hanya60%guruyangmenyusunsilabusdan

RPP,2)Secarakualitas,silabusdanRPPyang

baikbarumencapai angka30%dari silabus

danRPPyangdibuatolehguru.

Kompetensi Guru

Berpedomankepadatujuanpendidikan

yakni meningkatkan kualitas sumber daya

manusia.Dalamusahameningkatkankualitas

sumber daya pendidikan, guru merupakan

komponensumberdayamanusiayangharus

dibina dan dikembangkan terus-menerus.

Potensi sumber daya guru itu perlu terus

tumbuh dan berkembang agar dapat

melakukanfungsinyasecarapotensial.Selain

itu pengaruh perubahan yang serba cepat

menuntut guru-guru untuk terus-menerus

belajar menyesuaikan diri dengan per-

kembanganilmupengetahuandanteknologi

sertamobilitasmasyarakat.

Masyarakat mempercayai, mengakui

dan menyerahkan kepada guru untuk

mendidik tunas-tunasmuda danmembantu

mengembangkan potens inya secara

professional. Kepercayaan, keyakinan, dan

penerimaan ini merupakan substansi dari

pengakuanmasyarakatterhadapprofesiguru.

Implikasi dari pengakuan tersebut meng-

haruskan guru memiliki kualitas yang

memadai.Tidakhanyapadatatarannormatif

saja namun mampu mengembangkan

kompetensi yang dimiliki, baik kompetensi

personal , professional , maupun ke-

masyarakatan dalam selubung aktualisasi

kebijakanpendidikan.

Profesionalismemenjadituntutandari

setiap pekerjaan. Apalagi profesi guru yang

sehari-hari menangani benda hidup

berupa siswa dengan berbagai

karakteristikyangmasing-masingtidaksama.

Pekerjaaansebagaigurumenjadilebihberat

ketikamenyangkut peningkatan kemam-

puan anak didiknya, sedangkankemam-

puandirinyamengalamistagnasi.Guruyang

profesional adalah mereka yang memiliki

kemampuan profesional dengan berbagai

kapasitasnya sebagai pendidik. Studi yang

dilakukan oleh Ace Suryani menunjukkan

bahwa Guru yang bermutu dapat diukur

dengan lima indikator, yaitu: pertama,

kemampuan profesional (professional

capacity), sebagaimana terukur dari ijazah,

jenjang pendidikan, jabatan dan golongan,

serta pelatihan. Kedua, upaya profesional

(professional efforts), sebagaimana terukur

dari kegiatan mengajar, pengabdian dan

penelitian. Ketiga, waktu yangdicurahkan

untuk kegiatan profesional (teacher's time),

sebagaimana terukur dari masa jabatan,

pengalaman mengajar serta lainnya.

Keempat, kesesuaian antara keahlian dan

pekerjaannya(linkandmatch),sebagaimana

terukur dari mata pelajaran yang diampu,

apakah telah sesuaidengan spesialisasinya

atautidak,sertakelima,tingkatkesejahteraan

(prosperiousity) sebagaimana terukur dari

upah, honor atau penghasilan rutinnya.

Tingkat kesejahteraan yang rendah bisa

mendorong seorang pendidik untuk

melakukan kerja sambilan, dan bilamana

kerjasambilaninisukses,bisajadiprofesi

UPAYAPENINGKATANKOMPETENSIGURUDALAMMENYUSUNSILABUSDANRPPMELALUI SUPERVISIAKADEMIKYANGBERKELANJUTAN

DISDNEGERI001TAREMPA

Riawati*

Abstrak: Penelitian ini bertujuan untuk mengetahui kopetensi guru dalam menyusun perangkatpembelajaran.JenisPenelitianiniPenelitianTindakanSekolah(PTS).PopulasipenelitianiniadalahseluruhguruSDnegeri001Tarempa.Prosespenelitiandengantindakanyangdilaluidengansiklus,yangteridiridariduasiklus.SupervisiakademiksecaraberkelanjutanterbuktisecarailmiahdapatmeningkatkankompetensigurudalammenyusunsilabusdanRencanaPelaksanaanPembelajaran(RPP)diSDNegeri001TarempaKepulauanAnambas,Hasilpenelitianpadasiklus Imeningkatnya jumlahsilabusyangdibuatguruyangberkualitasbaikdari31%menjadi83%setelahsupervisiakademik.SelainitujumlahRencanaPelaksanaanPembelajaran(RPP)yangberkualitasbaikjugameningkatpadasilkusIIdari38%menjadi89%.

KataKunci:KompetensiGuru,SupervisiAkademik

PENDAHULUAN

Peran pendidikan sangat menentukan

perkembangandanperwujudandiriindividu,

terutama bagi pembangunan bangsa dan

negara. Tujuan pendidikan pada umumnya

adalah menyediakan lingkungan yang

memungkinkanpesertadidikuntukmengem-

bangkan bakat dan kemampuannya secara

optimal. Salah satu bantuan yang diberikan

pendidikan agar terjadi proses yang meng-

hasilkan ilmu pengetahuan, penguasaan,

kemahiran, tabiat, serta pembentukan sikap

dankeyakinanpesertadidikuntukmengem-

bangkan bakat dan kemampuannya melalui

prosespembelajaran.

Pembelajarandiartikansebagaiproses

interaksipesertadidikdenganpendidikdan

sumberbelajarpadasuatulingkunganbelajar

(UUNo20Tahun2003).Dewasaini,konteks

pembelajaran diarahkan dalam pendekatan

pembelajaran tematik yang menggunakan

tema untuk mengaitkan beberapa mata

pelajaran dan materi sehingga dapat

memberikan pengalaman yang bermakna

padapesertadidik.

Pembelajaran mengandung tiga hal

pokok yakni perencanaan, pelaksanaan dan

evaluasi.Perencanaan program berfungsi

untuk memberikan arah pelaksanaan

pembelajaransehinggamenjaditerarahdan

e�isien.Salahsatubagiandariperencanaan

pembelajaranyangsangatpentingdibuatoleh

guru sebagaipengarahpembelajaranadalah

silabus dan Rencana Pelaksanaan Pem-

belajaran(RPP).Silabus memberikan arah

tentang apa saja yang harus dicapai guna

menggapai tujuan pembelajaran dan cara

seperti apa yang akan digunakan. Selain itu

silabusjugamemuatteknikpenilaianseperti

sejauh mana keberhasilan pembelajaran.

Rencana Pelaksanaan Pembelajaran (RPP)

adalah instrumen perencanaan yang lebih

spesi�ik dari silabus. Rencana Pelaksanaan

Pembelajaran (RPP) ini dibuat untuk

memandugurudalammengajaragartidak

melebar jauh dari tujuan pembelajaran.

Dengan melihat pentingnya penyusunan

perencanaan pembelajaran ini , guru

semestinya tidak mengajar tanpa adanya

rencana. Namun dapat disayangkan karena

perencanaan pembelajaran tidak dapat

diukur oleh kepala sekolah sebab hanya

direncanakan dalam pikiran sang guru saja.

Page 88: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

88 89

perilaku-perilaku kognitif, afektif, dan

psikomotorikdengansebaik-baiknya.

Berdasarkanuraiandiataskompetensi

gurudapatdide�inisikansebagaipenguasaan

terhadappengetahuan,keterampilan,nilai

dan sikap yang dire�leksikan dalam

kebiasaan berpikir dan bertindak dalam

menjalankanprofesisebagaiguru.

METODOLOGIPENELITIAN

JenisPenelitian

Penelitian ini menggunakan pen-

dekatan kuantitatif. Jenis penelitian yang

digunakanyaitupenelitiantindakansekolah.

TempatdanWaktuPenelitian

Penelitian dilaksanakan di SD Negeri

001Tarempa.Waktupenelitianadalahpada

semestergenap,yaitusemesterItanggal1s/d

30apriltahunajaran2015/2016.

PopulasidanSampel

Populasi dan sampel dalam penelitian

ini adalah seluruh guru SD Negeri 001

Tarempaajaran2015/2016yangjumlahguru

26orang.

DesainPenelitian

Desain yang digunakan dalam pene-

litian ini adalah tindakan sekolah yang

menggunansiklusdimulaidariperencanaan,

pelaksaan,obsevasidanre�leksi.

Data,InstrumendanTeknikPengumpulan

Data

Data yang diperlukan adalah data

tentang penguasaan konsep dan kreativitas

siswa. Data dikumpulkan dengan cara tes.

Instrumen yangdigunakan adalahPedoman

TesPenguasaanKonsepTemaKegemarandan

Pedoman Tes Kreativitas, Instrumen yang

digunakan divalidasi dan diuji reliabilitas

sebelumdigunakan.

TeknikAnalisisData

Teknikanalisisdatadalampenelitian

ini menggunakan statistik deskriptif dan

statistika inferensial. Statistik deskriptif

digunakanuntukmenyajikandatayangtelah

diperolehdarihasilsetiapsiklus.

HASIL PENELITIAN DAN

PEMBAHASAN

Hasil Penelitian

Datadalampenelitianiniterdiridari

hasilkualitasguruyangmenyusunperangkat

pembelajaran berupa silabus dan RPP dari

datasiklusIdandatasiklusII.Datakualitas

perangkat pembelajaran guru dapat dilihat

padadiagrampadagambar1.

Gambar1.DiagramRata-rataKualitasPerangkatPembelajaranGuruSiklusI

Berdasarkan gambar 1 diketahui

bahwajelasterlihatbahwakualitassilabusda

RPP guru SDN 001 Tarempa Kecamatan

SiantanKabupatenKepulauanAnambaspada

tahun pelajaran 2015/206 masih sangat

rendah.Dari15orangguruyangsilabusdan

RPP-nya dianalisa oleh peneliti, hanya rata-

rata31%,guruyangmemilikisilabusdanRPP

yang sesuai dan dinilai baik. Lebih rinci,

mengajarnya berubah menjadi sambilan.

Guru yang profesional amat berarti bagi

pembentukan sekolah unggulan. Guru

profesional memiliki pengalaman mengajar,

kapasitasintelektual,moral,keimanan,ketaq-

waan, disiplin, tanggungjawab, wawasan

kependidikan yang luas, kemampuan

manajerial, terampil, kreatif, memiliki

keterbukaan profesional dalam memahami

potensi, karakteristik dan masalah

perkembangan peserta didik, mampu

mengembangkan rencana studi dan karir

peserta didik serta memiliki kemampuan

menelitidanmengembangkankurikulum.

Makin kuatnya tuntutan akan profe-

sionalismegurubukanhanyaberlangsungdi

Indonesia,melainkandinegara-negaramaju,

seperti Amerika Serikat, isu tentang

profesionalismegururamaidibicarakanpada

pertengahan tahun 1980-an. Seperti yang

dikemukakan oleh Supriadi (1999 p.98)

untuk menjadi professional, seorang guru

dituntut memiliki lima hal, yakni: a) Guru

mempunyaikomitmenpadasiswadanproses

belajarnya. Ini berarti bahwa komitmen

tertinggi guru adalah kepada kepentingan

siswanya; b) Guru menguasai secara

mendalam bahan/mata pelajaran yang

diajarkansertacaramengajarkannyakepada

siswa.Bagiguru,hal inimerupakanduahal

yang tidak dapat dipisahkan; c) Guru

bertanggung jawab memantau hasil belajar

siswamelaluiberbagaiteknikevaluasi,mulai

cara pengamatan dalam perilaku siswa

sampai tes hasil belajar; d) Guru mampu

berpikir sistematis tentang apa yang

dilakukannya, dan belajar dari penga-

lamannya. Artinya, harus selalu ada waktu

untukguruguna mengadakan re�leksi dan

koreksi terhadap apa yang telah

dilakukannya. Untuk bisa belajar dari

pengalaman,iaharustahumanayangbenar

dan salah, sertabaikdanburukdampaknya

pada proses belajar siswa; e) Guru seyog-

yanya merupakan bagian dari masyarakat

belajar dalam lingkungan profesinya,

misalnyaPGRIdanorganisasiprofesilainnya

Untuk mengatasi permasalahan

tersebut, perlunya seorang guru yang pro-

fessional dan berkompetensi, sebagaimana

(Majid, 2005: 6) menjelaskan kompetensi

yang dimiliki oleh setiap guru akan

menunjukkankualitasgurudalammengajar.

Kompetensi tersebut akan terwujud dalam

bentuk penguasaan pengetahuan dan

profesional dalam menjalankan fungsinya

sebagai guru. selanjutnya Diyakini

(Robotham, 1996: 27), kompetensi yang

diperlukan oleh seseorang tersebut dapat

diperoleh baik melalui pendidikan formal

maupunpengalaman.

Sejalan dengan pengertian yang

diberikan oleh Diyakini (Robothan Syah,

2000: 229) mengemukakan pengertian

dasar kompetensiadalahkemampuanatau

kecakapan. (Usman, 1994: 1) juga

mengemukakan kompentensi berarti suatu

hal yang menggambarkan kuali�ikasi atau

kemampuan seseorang, baik yang kualitatif

maupun yang kuantitatif. (McAhsan, 1981:

45), sebagaimana dikutip oleh (Mulyasa,

2 003 : 3 8 ) mengemukakan b ahwa

kompetensi: “…is aknowledge, skills, and

abilitiesorcapabilitiesthatapersonachieves,

which become part of his or herbeing to the

extent he or she can satisfactorily perform

particular cognitive, affective, and psy-

chomotor behaviors” . Dalam hal ini ,

kompetensi diartikan sebagai pengetahuan,

keterampilan,dankemampuanyangdikuasai

olehseseorangyangtelahmenjadibagiandari

dirinya, sehingga ia dapat melakukan

Page 89: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

88 89

perilaku-perilaku kognitif, afektif, dan

psikomotorikdengansebaik-baiknya.

Berdasarkanuraiandiataskompetensi

gurudapatdide�inisikansebagaipenguasaan

terhadappengetahuan,keterampilan,nilai

dan sikap yang dire�leksikan dalam

kebiasaan berpikir dan bertindak dalam

menjalankanprofesisebagaiguru.

METODOLOGIPENELITIAN

JenisPenelitian

Penelitian ini menggunakan pen-

dekatan kuantitatif. Jenis penelitian yang

digunakanyaitupenelitiantindakansekolah.

TempatdanWaktuPenelitian

Penelitian dilaksanakan di SD Negeri

001Tarempa.Waktupenelitianadalahpada

semestergenap,yaitusemesterItanggal1s/d

30apriltahunajaran2015/2016.

PopulasidanSampel

Populasi dan sampel dalam penelitian

ini adalah seluruh guru SD Negeri 001

Tarempaajaran2015/2016yangjumlahguru

26orang.

DesainPenelitian

Desain yang digunakan dalam pene-

litian ini adalah tindakan sekolah yang

menggunansiklusdimulaidariperencanaan,

pelaksaan,obsevasidanre�leksi.

Data,InstrumendanTeknikPengumpulan

Data

Data yang diperlukan adalah data

tentang penguasaan konsep dan kreativitas

siswa. Data dikumpulkan dengan cara tes.

Instrumen yangdigunakan adalahPedoman

TesPenguasaanKonsepTemaKegemarandan

Pedoman Tes Kreativitas, Instrumen yang

digunakan divalidasi dan diuji reliabilitas

sebelumdigunakan.

TeknikAnalisisData

Teknikanalisisdatadalampenelitian

ini menggunakan statistik deskriptif dan

statistika inferensial. Statistik deskriptif

digunakanuntukmenyajikandatayangtelah

diperolehdarihasilsetiapsiklus.

HASIL PENELITIAN DAN

PEMBAHASAN

Hasil Penelitian

Datadalampenelitianiniterdiridari

hasilkualitasguruyangmenyusunperangkat

pembelajaran berupa silabus dan RPP dari

datasiklusIdandatasiklusII.Datakualitas

perangkat pembelajaran guru dapat dilihat

padadiagrampadagambar1.

Gambar1.DiagramRata-rataKualitasPerangkatPembelajaranGuruSiklusI

Berdasarkan gambar 1 diketahui

bahwajelasterlihatbahwakualitassilabusda

RPP guru SDN 001 Tarempa Kecamatan

SiantanKabupatenKepulauanAnambaspada

tahun pelajaran 2015/206 masih sangat

rendah.Dari15orangguruyangsilabusdan

RPP-nya dianalisa oleh peneliti, hanya rata-

rata31%,guruyangmemilikisilabusdanRPP

yang sesuai dan dinilai baik. Lebih rinci,

mengajarnya berubah menjadi sambilan.

Guru yang profesional amat berarti bagi

pembentukan sekolah unggulan. Guru

profesional memiliki pengalaman mengajar,

kapasitasintelektual,moral,keimanan,ketaq-

waan, disiplin, tanggungjawab, wawasan

kependidikan yang luas, kemampuan

manajerial, terampil, kreatif, memiliki

keterbukaan profesional dalam memahami

potensi, karakteristik dan masalah

perkembangan peserta didik, mampu

mengembangkan rencana studi dan karir

peserta didik serta memiliki kemampuan

menelitidanmengembangkankurikulum.

Makin kuatnya tuntutan akan profe-

sionalismegurubukanhanyaberlangsungdi

Indonesia,melainkandinegara-negaramaju,

seperti Amerika Serikat, isu tentang

profesionalismegururamaidibicarakanpada

pertengahan tahun 1980-an. Seperti yang

dikemukakan oleh Supriadi (1999 p.98)

untuk menjadi professional, seorang guru

dituntut memiliki lima hal, yakni: a) Guru

mempunyaikomitmenpadasiswadanproses

belajarnya. Ini berarti bahwa komitmen

tertinggi guru adalah kepada kepentingan

siswanya; b) Guru menguasai secara

mendalam bahan/mata pelajaran yang

diajarkansertacaramengajarkannyakepada

siswa.Bagiguru,hal inimerupakanduahal

yang tidak dapat dipisahkan; c) Guru

bertanggung jawab memantau hasil belajar

siswamelaluiberbagaiteknikevaluasi,mulai

cara pengamatan dalam perilaku siswa

sampai tes hasil belajar; d) Guru mampu

berpikir sistematis tentang apa yang

dilakukannya, dan belajar dari penga-

lamannya. Artinya, harus selalu ada waktu

untukguruguna mengadakan re�leksi dan

koreksi terhadap apa yang telah

dilakukannya. Untuk bisa belajar dari

pengalaman,iaharustahumanayangbenar

dan salah, sertabaikdanburukdampaknya

pada proses belajar siswa; e) Guru seyog-

yanya merupakan bagian dari masyarakat

belajar dalam lingkungan profesinya,

misalnyaPGRIdanorganisasiprofesilainnya

Untuk mengatasi permasalahan

tersebut, perlunya seorang guru yang pro-

fessional dan berkompetensi, sebagaimana

(Majid, 2005: 6) menjelaskan kompetensi

yang dimiliki oleh setiap guru akan

menunjukkankualitasgurudalammengajar.

Kompetensi tersebut akan terwujud dalam

bentuk penguasaan pengetahuan dan

profesional dalam menjalankan fungsinya

sebagai guru. selanjutnya Diyakini

(Robotham, 1996: 27), kompetensi yang

diperlukan oleh seseorang tersebut dapat

diperoleh baik melalui pendidikan formal

maupunpengalaman.

Sejalan dengan pengertian yang

diberikan oleh Diyakini (Robothan Syah,

2000: 229) mengemukakan pengertian

dasar kompetensiadalahkemampuanatau

kecakapan. (Usman, 1994: 1) juga

mengemukakan kompentensi berarti suatu

hal yang menggambarkan kuali�ikasi atau

kemampuan seseorang, baik yang kualitatif

maupun yang kuantitatif. (McAhsan, 1981:

45), sebagaimana dikutip oleh (Mulyasa,

2 003 : 3 8 ) mengemukakan b ahwa

kompetensi: “…is aknowledge, skills, and

abilitiesorcapabilitiesthatapersonachieves,

which become part of his or herbeing to the

extent he or she can satisfactorily perform

particular cognitive, affective, and psy-

chomotor behaviors” . Dalam hal ini ,

kompetensi diartikan sebagai pengetahuan,

keterampilan,dankemampuanyangdikuasai

olehseseorangyangtelahmenjadibagiandari

dirinya, sehingga ia dapat melakukan

Page 90: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

90 91

supervisi kelas. Hal ini dilakukan untuk

menyesuaikan rencana yang dimuat dalam

silabus dan RPP dengan penerapannya di

kelas. Jika sesuai maka dapat dipastikan,

kompetensi guru dalam menyusun silabus

dan RPP tersebut benar (bukan jiplakan

ataudibuatkanoranglain).Jikabanyak

ketidaksesuaian maka ada kemungkinan

silabus dan RPP tersebut dibuatkan oleh

oranglain.

Saran

Berdasarkan hasil penelitian, saran

yang dapat disampaikan untuk para kepala

sekolah yaitu pelaksanaan supervis i

individual sangat cocok digunakan untuk

meningkatkan kompetensi guru dalam

menyusunsilabusdanRPPyangselama

inimasihmenjadiadministrasiyangmasih

sul i t d iminta dar i guru-guru . Untuk

mengujinya, kita dapat menggunakan

supervisikelas.Untukpengawasdiharapkan

dapatmemberikanmasukanyanglebihjelas

danterarahdalampembinaanterhadapguru.

DaftarPustaka

Anwar, Moch. Idochi. (2004). AdministrasiPendidikan dan Manajemen BiayaPendidikan.Bandung:Alfabeta

Depdiknas. (1997). Petunjuk PengelolaanAdminstrasi Sekolah Dasar. Jakarta:Depdiknas.

Depdiknas. (2001). Manajemen PeningkatanMutu Berbasis Sekolah . Jakarta:Depdiknas.

Depdiknas. (2010). Supervisi Akademik;M a t e r i P e l a t i h a n P e n g u a t a nKemampuanKepalaSekolah; Jakarta:Depdiknas.

Harahap. (1983). Supervisi Pendidikan yangDilaksanakan oleh Guru, KepalaSekolah,PenilikdanPengawasSekolah.Jakarta:DamaiJaya.

Majid.(2005). Perencanaan Pembelajaran:Mengembangkan Standar KompetensiG u r u . B a n d u n g : P T R em a j aRosdakarya.

Muhaimin. (2004). Paradigma PendidikanI s l a m . B a n d u n g : P T R em a j aRosdakarya.

Sahertian,PietA.(2000).Konsep-KonsepdanTeknik Supervisi Pendidikan DalamRangkaPengembanganSumberDayaManusia.Jakarta:RinekaCipta.

Sapari, Achmad. (2002). Pemahaman GuruTerhadap Inovasi Pendidikan. Artikel.Jakarta:Kompas(16Agustus2002).

Supandi. (1996). Administrasi dan SupervisiPendidikan Jakarta: DepartemenAgamaUniversitasTerbuka.

presentaseguruyangsilabusnyabaik(diatas

70)adalah23%danguruyangRPPnyabaik

(diatas70)adalah33%.

Selanjutnyasetelahdilakukan

supervisidanbimbinganberkelanjutanpada

guru-gurudidapatihasilpadasiklusIIseperti

terlihatpadagambar2.

Gambar 2. Diagram Rata-rata KualitasPerangkat Pembelajaran GuruSiklusII

Dari data jumlah guru yangmengumpulkan

silabus dan RPP pada awal siklus 1, dapat

terlihat bahwa dengan informasi adanya

supervisi akademik terhadap guru dapat

meningkatkan kuantitas jumlah guru yang

menyusunsilabusdanRPPyangsebelumnya

hanya 83%, mengalami peningkatan

kuantitasmenjadi89%.

Dari data diatas dapat disimpulkan

bahwa terjadinya peningkatan dalam

menyusunanperangkatpembelajaransetelah

melalui proses supervisi akademik yang

berkelanjutan.

HasilPenelitian

Setelah dilakukan penelitian melalui

siklus Idansiklus IImakadidapatihasilnya

sebagaiberikut.

Gambar3.DiagrambatangRata-rataKualitasPerangkatPembelajaranGuruSiklusIdansiklusII

Supervisiakademiksecaraberkelanjutan

terbukti dapat meningkatkan koptensi guru

dalam menyusun perangkat pembelajaran.

hal ini terbukti dari hasil data di atas pada

siklus I silabus guru dari 31% meningkat

menjadi 83%, selanjtnya RPP dari 31%

meningkatmenjadi89%.

SIMPULANDANSARAN

Simpulan

Supervisiakademiksecaraberkelanjutan

terbukti secara ilmiah dapat meningkatkan

kompetensi guru dalam menyusun silabus

danRPPdiSDN001Tarempa,meningkatnya

jumlah silabus guru yang baik dari 31%

menjadi 83% setelah supervisi akademik.

Selain itu jumlahRPP yang berkualitas baik

juga meningkat dari 38% menjadi 89%.

Denganprosesdan langkah-langkah yang

mengakibatkan terjadinya peningkatan

kompetensi guru dalam menyusun silabus

dan RPP tersebut meliputi langkah-langkah

sebagai berikut: a) pengumuman rencana

supervisi terhadap guru, b) pelaksanaan

supervisi individual, dimana setiap guru

dimintamempresentasikansilabusdanRPP-

nyakepadakepalasekolah,kemudiankepala

sekolah memberikan masukan terhadap

kekurangan silabus dan RPP guru, c) untuk

mengecek originalitas silabus danRPP yang

disusun guru, kepala sekolah melakukan

Page 91: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

90 91

supervisi kelas. Hal ini dilakukan untuk

menyesuaikan rencana yang dimuat dalam

silabus dan RPP dengan penerapannya di

kelas. Jika sesuai maka dapat dipastikan,

kompetensi guru dalam menyusun silabus

dan RPP tersebut benar (bukan jiplakan

ataudibuatkanoranglain).Jikabanyak

ketidaksesuaian maka ada kemungkinan

silabus dan RPP tersebut dibuatkan oleh

oranglain.

Saran

Berdasarkan hasil penelitian, saran

yang dapat disampaikan untuk para kepala

sekolah yaitu pelaksanaan supervis i

individual sangat cocok digunakan untuk

meningkatkan kompetensi guru dalam

menyusunsilabusdanRPPyangselama

inimasihmenjadiadministrasiyangmasih

sul i t d iminta dar i guru-guru . Untuk

mengujinya, kita dapat menggunakan

supervisikelas.Untukpengawasdiharapkan

dapatmemberikanmasukanyanglebihjelas

danterarahdalampembinaanterhadapguru.

DaftarPustaka

Anwar, Moch. Idochi. (2004). AdministrasiPendidikan dan Manajemen BiayaPendidikan.Bandung:Alfabeta

Depdiknas. (1997). Petunjuk PengelolaanAdminstrasi Sekolah Dasar. Jakarta:Depdiknas.

Depdiknas. (2001). Manajemen PeningkatanMutu Berbasis Sekolah . Jakarta:Depdiknas.

Depdiknas. (2010). Supervisi Akademik;M a t e r i P e l a t i h a n P e n g u a t a nKemampuanKepalaSekolah; Jakarta:Depdiknas.

Harahap. (1983). Supervisi Pendidikan yangDilaksanakan oleh Guru, KepalaSekolah,PenilikdanPengawasSekolah.Jakarta:DamaiJaya.

Majid.(2005). Perencanaan Pembelajaran:Mengembangkan Standar KompetensiG u r u . B a n d u n g : P T R em a j aRosdakarya.

Muhaimin. (2004). Paradigma PendidikanI s l a m . B a n d u n g : P T R em a j aRosdakarya.

Sahertian,PietA.(2000).Konsep-KonsepdanTeknik Supervisi Pendidikan DalamRangkaPengembanganSumberDayaManusia.Jakarta:RinekaCipta.

Sapari, Achmad. (2002). Pemahaman GuruTerhadap Inovasi Pendidikan. Artikel.Jakarta:Kompas(16Agustus2002).

Supandi. (1996). Administrasi dan SupervisiPendidikan Jakarta: DepartemenAgamaUniversitasTerbuka.

presentaseguruyangsilabusnyabaik(diatas

70)adalah23%danguruyangRPPnyabaik

(diatas70)adalah33%.

Selanjutnyasetelahdilakukan

supervisidanbimbinganberkelanjutanpada

guru-gurudidapatihasilpadasiklusIIseperti

terlihatpadagambar2.

Gambar 2. Diagram Rata-rata KualitasPerangkat Pembelajaran GuruSiklusII

Dari data jumlah guru yangmengumpulkan

silabus dan RPP pada awal siklus 1, dapat

terlihat bahwa dengan informasi adanya

supervisi akademik terhadap guru dapat

meningkatkan kuantitas jumlah guru yang

menyusunsilabusdanRPPyangsebelumnya

hanya 83%, mengalami peningkatan

kuantitasmenjadi89%.

Dari data diatas dapat disimpulkan

bahwa terjadinya peningkatan dalam

menyusunanperangkatpembelajaransetelah

melalui proses supervisi akademik yang

berkelanjutan.

HasilPenelitian

Setelah dilakukan penelitian melalui

siklus Idansiklus IImakadidapatihasilnya

sebagaiberikut.

Gambar3.DiagrambatangRata-rataKualitasPerangkatPembelajaranGuruSiklusIdansiklusII

Supervisiakademiksecaraberkelanjutan

terbukti dapat meningkatkan koptensi guru

dalam menyusun perangkat pembelajaran.

hal ini terbukti dari hasil data di atas pada

siklus I silabus guru dari 31% meningkat

menjadi 83%, selanjtnya RPP dari 31%

meningkatmenjadi89%.

SIMPULANDANSARAN

Simpulan

Supervisiakademiksecaraberkelanjutan

terbukti secara ilmiah dapat meningkatkan

kompetensi guru dalam menyusun silabus

danRPPdiSDN001Tarempa,meningkatnya

jumlah silabus guru yang baik dari 31%

menjadi 83% setelah supervisi akademik.

Selain itu jumlahRPP yang berkualitas baik

juga meningkat dari 38% menjadi 89%.

Denganprosesdan langkah-langkah yang

mengakibatkan terjadinya peningkatan

kompetensi guru dalam menyusun silabus

dan RPP tersebut meliputi langkah-langkah

sebagai berikut: a) pengumuman rencana

supervisi terhadap guru, b) pelaksanaan

supervisi individual, dimana setiap guru

dimintamempresentasikansilabusdanRPP-

nyakepadakepalasekolah,kemudiankepala

sekolah memberikan masukan terhadap

kekurangan silabus dan RPP guru, c) untuk

mengecek originalitas silabus danRPP yang

disusun guru, kepala sekolah melakukan

Page 92: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

92 93

Kebiasaan siswa untuk saling me-

ngajarkan dalam memahami materi dapat

diwujudkan melalui pembelajaran ber-

ke l ompok ( c o o p e ra t i v e l e a r n i n g ) .

Keberagamanpengetahuansiswadalamsuatu

kelompok menjadikan siswa yang ber-

pemahamanlebihdapatmengajarkanteman

lainnyayangmasihkurangmemahamidengan

gayadanbahasayang lebihmudahditerima

tanpa harus merasa malu karena dianggap

tidak mampu. Dan merupakan suatu

keuntungan karena bertindak sebagai tutor

menuntut untuk berpikir lebih tentang

hubungan di antara berbagai ide materi

pelajaran. Hal yang sama juga diungkapkan

olehSlavin(2008)penggunaanpembelajaran

kooperatif untuk meningkatkan pencapaian

prestasi para siswa, dan juga akibat-akibat

positif lainnya yang dapat mengembangkan

hubungan antar kelompok, penerimaan

terhadap teman sekelas yang lemah dalam

akademik,danmeningkatkanrasahargadiri.

Penelitian yang berkaitan dengan

pembelajaran kooperatif sudah dilakukan

oleh beberapa peneliti. Hikmah (2013)

menerapkanmodelpembelajarankooperatif

tipe STAD dengan media manipulatif untuk

menentukanrumusvolumebangunruangsisi

datar, Risliana (2013) menerapkan model

pembelajarankooperatiftipeNumberedHead

Together (NHT) untuk meningkatkan hasil

belajarmatematikasiswapadamateribangun

ruang. Sopiah (2013) menerapkan model

pembelajaran kooperatif tipe Two Stay Two

Stray (TSTS) untuk meningkatkan pe-

mahaman siswa dalam menemukan rumus

luas trapesium, Purwanto (2011) men-

jelaskanbahwapembelajarankooperatifyang

membuatsiswayangbekerjadalamkelompok

akan belajar lebih banyak dibandingkan

dengan siswa yang kelasnya dikelola secara

tradisional.

Pembelajaran kooperatif akan lebih

menarik dan menyenangkan jika siswa

terlibatlangsungdenganbantuanmediadan

mempraktekkanmasalahmatematikadalam

kegiatan. Marlina (2013) bahwa pem-

belajaran kooperatif dengan menggunakan

mediamembuatsiswalebihbanyakberpikir,

berbuat, dan berbagi. Sehingga diharapkan

penerapanmediadanpraktekdapatmembuat

matematika yang sifatnya abstrak menjadi

lebihkonkret.

Senada dengan pendapat Gunawati

(2013) menyatakan pembelajaran ma-

tematika berbantuan media menghadirkan

objek nyata yangmempunyai peran penting

dalam memahamkan konsep matematika

yangbersifatabstrak.

Selain media, pembelajaran ma-

tematika secara praktek dapat dilakukan

dengan permainan yang dapat menarik

perhatian, minat dan partisipasi aktif siswa

sertadapatmembawasiswakedalamsuasana

belajar yang lebih hidup. Pemainan sangat

dibutuhkan dalam belajar matematika, agar

matematika tidak menjadi objek yang

“gersang”.(Subanji,2009).

Pada dasarnya permainan ma-

tematikadigunakanuntukmemotivasisiswa

supaya lebih giat belajar matematika.

Permainan matematika juga dapat me-

ningkatkan nilai-nilai: inisiatif individu,

bekerjasama, rasa hormat terhadap opini

orang lain, sikap sportif, dan daya saing.

Permainan juga dapat menumbuhkan

pemahaman konsep, operasi, dan prinsip

dalammatematika(Subanji,2013).

Penelitiandenganpermainan sudah

dilakukanolehbeberapapeneliti. ImurIriani

dalam mayatun (2014) menjelaskan bahwa

“denganpermainanataugamesiswamenjadi

PENERAPANPEMBELAJARANKOOPERATIFMATERIFUNGSIKOMPOSISIDENGANPERMAINANESTAFETUNTUKMENINGKATKANHASILBELAJARSISWAKELASXI

SMANEGERI10BATAM

RizkiKurniaZulhijjahBatubara*

Abstrak:Penelitianinibertujuanmendeskripsikanpenerapanpembelajarankooperatifdenganpermainanestafetyangberfungsiuntukmemahamkankonsepmatematikayangabstrakmelaluikegiatannyatadenganharapan dapat meningkatkan hasil belajar siswa SMA Negeri 10 Batam pada materi fungsi komposisi.Penelitian iniadalahPenelitianTindakanKelas (PTK),mengacupadametodeKemmisdanTaggartyangterdiriatas4tahapandandilakukansebanyak2siklus.Hasilpenelitiandilakukandenganmembandingkanhasiltespadasikluspertamadenganhasiltespadasikluskeduamenunjukkanbahwaadanyapeningkatanrata-ratahasilbelajarsiswasebesar19,35%.Ketuntasanbelajarsiswajugameningkatdari10,71%menjadi57,14%.Melaluiobservasiyangdilakukanpenelititingkatkeaktifansiswadalamprosespembelajaranpadasikluskeduajugaturutmeningkatdibandingkandenganprosespembelajaransebelummenerapkanmetodepermainan.

KataKunci:Kooperatif,PermainanEstafet,danHasilBelajar.

PENDAHULUAN

Pelajaran matematika merupakan

pelajaranyangtidakbisalepasdarikehidupan

kita sehari-hari. Hampir seluruh aktivitas

manusia didasari oleh ilmu matematika.

Tetapi ironisnya keadaan benar-benar

bertolakbelakangdenganrealita.Darizaman

belum majunya teknologi sampai sekarang

pelajaranmatematikaselalumenjadimomok,

terutamabagianak-anaksekolah.

Tanyakanpada siswamaka sebagian

besar akan merasa kesulitan dalam me-

mahamimatematikamaterifungsikomposisi.

Padahalmaterifungsikomposisimerupakan

materiyangselalumasuksoalUjianNasional

(UN) baik untuk matematika IPA maupun

matematikaIPS,danmaterifungsikomposisi

merupakanmateriyangtingkatkesukarannya

sedang, namun kemampuan siswa untuk

menyelesa ikan permasalahan fungs i

komposisi masih rendah, terbukti masih

banyak siswa yang salah dalam soalan ini.

Penerapanfungsikomposisidalamkehidupan

sehari-harijugasangateratdenganaktivitas

kita sehari-hari. Tetapi jarang anak dapat

melihataplikasinyawalaupunanakitusendiri

sudahseringmenerapkannya.

Kenyataannya masih kurang adanya

motivasi dari guru untuk menghubungkan

materi pelajaran kekehidupan nyata dan

minat belajar matematika siswa sangat

rendah karena membayangkan materi yang

abstrak membuat materi fungsi komposisi

menjadi sulit dan memberikan hasil belajar

yang rendah pula. Hal ini juga didukung

dengan kurang kreatifnya guru dalam

membuat variasi metode pembelajaran

matematika di kelas yang biasanya masih

berorientasi pada guru (teacher centred)

sedangkan siswa hanya pasif menjadi

pendengar.

Kenyataan ini membuat siswa lebih

nyaman untuk belajar dan bertanya kepada

siswa lainnya dalammemahamimateri dari

pada bertanya kepada guru yang cenderung

mengajarkanmaterisecaramonotondankaku

yang langsung memberi penugasan sebagai

tolak ukur pemahaman siswa akan materi

yangdiajarkan.

Page 93: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

92 93

Kebiasaan siswa untuk saling me-

ngajarkan dalam memahami materi dapat

diwujudkan melalui pembelajaran ber-

ke l ompok ( c o o p e ra t i v e l e a r n i n g ) .

Keberagamanpengetahuansiswadalamsuatu

kelompok menjadikan siswa yang ber-

pemahamanlebihdapatmengajarkanteman

lainnyayangmasihkurangmemahamidengan

gayadanbahasayang lebihmudahditerima

tanpa harus merasa malu karena dianggap

tidak mampu. Dan merupakan suatu

keuntungan karena bertindak sebagai tutor

menuntut untuk berpikir lebih tentang

hubungan di antara berbagai ide materi

pelajaran. Hal yang sama juga diungkapkan

olehSlavin(2008)penggunaanpembelajaran

kooperatif untuk meningkatkan pencapaian

prestasi para siswa, dan juga akibat-akibat

positif lainnya yang dapat mengembangkan

hubungan antar kelompok, penerimaan

terhadap teman sekelas yang lemah dalam

akademik,danmeningkatkanrasahargadiri.

Penelitian yang berkaitan dengan

pembelajaran kooperatif sudah dilakukan

oleh beberapa peneliti. Hikmah (2013)

menerapkanmodelpembelajarankooperatif

tipe STAD dengan media manipulatif untuk

menentukanrumusvolumebangunruangsisi

datar, Risliana (2013) menerapkan model

pembelajarankooperatiftipeNumberedHead

Together (NHT) untuk meningkatkan hasil

belajarmatematikasiswapadamateribangun

ruang. Sopiah (2013) menerapkan model

pembelajaran kooperatif tipe Two Stay Two

Stray (TSTS) untuk meningkatkan pe-

mahaman siswa dalam menemukan rumus

luas trapesium, Purwanto (2011) men-

jelaskanbahwapembelajarankooperatifyang

membuatsiswayangbekerjadalamkelompok

akan belajar lebih banyak dibandingkan

dengan siswa yang kelasnya dikelola secara

tradisional.

Pembelajaran kooperatif akan lebih

menarik dan menyenangkan jika siswa

terlibatlangsungdenganbantuanmediadan

mempraktekkanmasalahmatematikadalam

kegiatan. Marlina (2013) bahwa pem-

belajaran kooperatif dengan menggunakan

mediamembuatsiswalebihbanyakberpikir,

berbuat, dan berbagi. Sehingga diharapkan

penerapanmediadanpraktekdapatmembuat

matematika yang sifatnya abstrak menjadi

lebihkonkret.

Senada dengan pendapat Gunawati

(2013) menyatakan pembelajaran ma-

tematika berbantuan media menghadirkan

objek nyata yangmempunyai peran penting

dalam memahamkan konsep matematika

yangbersifatabstrak.

Selain media, pembelajaran ma-

tematika secara praktek dapat dilakukan

dengan permainan yang dapat menarik

perhatian, minat dan partisipasi aktif siswa

sertadapatmembawasiswakedalamsuasana

belajar yang lebih hidup. Pemainan sangat

dibutuhkan dalam belajar matematika, agar

matematika tidak menjadi objek yang

“gersang”.(Subanji,2009).

Pada dasarnya permainan ma-

tematikadigunakanuntukmemotivasisiswa

supaya lebih giat belajar matematika.

Permainan matematika juga dapat me-

ningkatkan nilai-nilai: inisiatif individu,

bekerjasama, rasa hormat terhadap opini

orang lain, sikap sportif, dan daya saing.

Permainan juga dapat menumbuhkan

pemahaman konsep, operasi, dan prinsip

dalammatematika(Subanji,2013).

Penelitiandenganpermainan sudah

dilakukanolehbeberapapeneliti. ImurIriani

dalam mayatun (2014) menjelaskan bahwa

“denganpermainanataugamesiswamenjadi

PENERAPANPEMBELAJARANKOOPERATIFMATERIFUNGSIKOMPOSISIDENGANPERMAINANESTAFETUNTUKMENINGKATKANHASILBELAJARSISWAKELASXI

SMANEGERI10BATAM

RizkiKurniaZulhijjahBatubara*

Abstrak:Penelitianinibertujuanmendeskripsikanpenerapanpembelajarankooperatifdenganpermainanestafetyangberfungsiuntukmemahamkankonsepmatematikayangabstrakmelaluikegiatannyatadenganharapan dapat meningkatkan hasil belajar siswa SMA Negeri 10 Batam pada materi fungsi komposisi.Penelitian iniadalahPenelitianTindakanKelas (PTK),mengacupadametodeKemmisdanTaggartyangterdiriatas4tahapandandilakukansebanyak2siklus.Hasilpenelitiandilakukandenganmembandingkanhasiltespadasikluspertamadenganhasiltespadasikluskeduamenunjukkanbahwaadanyapeningkatanrata-ratahasilbelajarsiswasebesar19,35%.Ketuntasanbelajarsiswajugameningkatdari10,71%menjadi57,14%.Melaluiobservasiyangdilakukanpenelititingkatkeaktifansiswadalamprosespembelajaranpadasikluskeduajugaturutmeningkatdibandingkandenganprosespembelajaransebelummenerapkanmetodepermainan.

KataKunci:Kooperatif,PermainanEstafet,danHasilBelajar.

PENDAHULUAN

Pelajaran matematika merupakan

pelajaranyangtidakbisalepasdarikehidupan

kita sehari-hari. Hampir seluruh aktivitas

manusia didasari oleh ilmu matematika.

Tetapi ironisnya keadaan benar-benar

bertolakbelakangdenganrealita.Darizaman

belum majunya teknologi sampai sekarang

pelajaranmatematikaselalumenjadimomok,

terutamabagianak-anaksekolah.

Tanyakanpada siswamaka sebagian

besar akan merasa kesulitan dalam me-

mahamimatematikamaterifungsikomposisi.

Padahalmaterifungsikomposisimerupakan

materiyangselalumasuksoalUjianNasional

(UN) baik untuk matematika IPA maupun

matematikaIPS,danmaterifungsikomposisi

merupakanmateriyangtingkatkesukarannya

sedang, namun kemampuan siswa untuk

menyelesa ikan permasalahan fungs i

komposisi masih rendah, terbukti masih

banyak siswa yang salah dalam soalan ini.

Penerapanfungsikomposisidalamkehidupan

sehari-harijugasangateratdenganaktivitas

kita sehari-hari. Tetapi jarang anak dapat

melihataplikasinyawalaupunanakitusendiri

sudahseringmenerapkannya.

Kenyataannya masih kurang adanya

motivasi dari guru untuk menghubungkan

materi pelajaran kekehidupan nyata dan

minat belajar matematika siswa sangat

rendah karena membayangkan materi yang

abstrak membuat materi fungsi komposisi

menjadi sulit dan memberikan hasil belajar

yang rendah pula. Hal ini juga didukung

dengan kurang kreatifnya guru dalam

membuat variasi metode pembelajaran

matematika di kelas yang biasanya masih

berorientasi pada guru (teacher centred)

sedangkan siswa hanya pasif menjadi

pendengar.

Kenyataan ini membuat siswa lebih

nyaman untuk belajar dan bertanya kepada

siswa lainnya dalammemahamimateri dari

pada bertanya kepada guru yang cenderung

mengajarkanmaterisecaramonotondankaku

yang langsung memberi penugasan sebagai

tolak ukur pemahaman siswa akan materi

yangdiajarkan.

Page 94: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

94 95

HASILDANPEMBAHASAN

HasilPenelitian

Kegiatan penelitian ini terintegrasi

dalam penelitian tindakan kelas yang

dilakukandalamduasiklusyangsetiapsiklus

terdiri dari empat tahapan: perencanaan,

pelaksanaantindakan,observasidanre�leksi.

SiklusI

Pada tahap perencanaan, peneliti

membuat rancangan pembelajaran dengan

mempersiapkan rencana pelaksanaan

pembelajaran (RPP) dan lembar aktivitas

siswa(LAS)sebagaimediapembelajaran.

Pada tahap pelaksanaan tindakan,

penelitimelakukanreal teaching yangsiklus

pertama dirancang empat kali pertemuan

dengan model pembelajaran kooperatif

denganmediaLAS.Untukpertemuanpertama

berlangsung pada hari Rabu, tanggal 7

Oktober 2015. Tahap awal guru mem-

persiapkanmentalsiswadenganmemberikan

salam dan mengecek kehadiran siswa,

mengkondisikandanmemusatkanperhatian

siswa dengan mengelompokkan siswa yang

terdiri dari 4 orang satu kelompok dan

membagikan LAS 1 kepada masing-masing

kelompokuntukmenggalipengetahuanawal

siswatentangfungsi.

Siswa diminta untuk mengamati

gambar-gambardiagrampanahyangadapada

LAS 1 dan menyuruh siswa mendiskusikan

yangmanakahdarigambar-gambartersebut

yang merupakan fungsi atau relasi biasa.

Setelah15menitgurumemintaduakelompok

untukmenjelaskanhasildiskusinyakedepan

kelasdankelompokyanglainnyamenanggapi

hasilpresentasekelompokyangtampil.Guru

menuntun s i swa untuk sama-sama

menyimpulkande�inisirelasidanfungsi.

Setelahmemahamkan de�inisi fungsi

padapertemuanpertama, gurumenjelaskan

tentangde�inisi sifat-sifatkhusus fungsidan

membagikan LAS 2 kepada siswa pada

pertemuankeduapadahariKamistanggal8

Oktober 2015. Siswa diminta untuk me-

ngamatigambar-gambaryang terdapatpada

LAS2danmendiskusikanyangmanakahdari

gambar-gambar tersebut yang memenuhi

sifatfungsiinjektif,surjektif,maupunbijektif.

Setelah15menit,duakelompoksiswadiminta

untuk mempresentasikan hasil diskusi

kelompoknya dan kelompok lainnya me-

nanggapi.Gurukembalimenuntunsiswapada

pemahamansifat-sifatfungsi.

Pertemuan ketiga siklus I pada hari

Rabu, 14 Oktober 2015 membahas tentang

operasialjabarfungsi.SiswadiberikanLAS3

dan bersama-sama dengan guru men-

diskusikan masalah operasi penjumlahan,

pengurangan,perkaliandanpembagianfungsi

dilanjutkandenganpresentasiolehbeberapa

kelompok dan kelompok yang lain me-

nanggapi. Kegiatan berikutnya dilanjutkan

dengan memberikan tes pada pertemuan

selanjutnya dan memberikan tindak lanjut

berupapenjelasantentangsoal-soaltesyang

tidakdipahamisiswa.

Kegiatanakhirsiklus1adalahre�leksi.

Berdasarkanhasilpengamatanguruterhadap

sikap siswamenunjukkan bahwamasih ada

beberapa siswa yang bermain, kurang aktif

dan tidak mau peduli dengan diskusi

kelompokmaupunhasilpembahasanmateri

yangdijelaskan.Sebagiansiswayanglainnya

yang memiliki pemahaman lebih kurang

bertoleransi terhadap siswa yang masih

kurangpahamsehinggamembuatsiswayang

kurangpahammenjadimalaskarenamerasa

diacuhkan.Halinijugadapatdilihatdarihasil

tesbeberapasiswayangmasihrendahkarena

bersikap acuh tak acuh selama proses

pembelajaran.

lebih terampil dalam mengerjakan tugas

menyelesaikansoal-soalmatematika.“

Oleh karena itu penulis mengangkat

masalah penerapan permainan estafet pada

materi fungsi komposisi yang diharapakan

untukmeningkatkanhasilbelajarsiswa.

METODEPENELITIAN

Penelitian ini merupakan Penelitian

TindakanKelas(PTK),yaitusuatupenelitian

yang dilakukan secara sistematis terhadap

berbagai“aksi”atautindakanyangdilakukan

o leh guru atau pelaku , mula i dar i

perencanaan, sampai dengan penelitian

terhadaptindakannyatadidalamkelasyang

berupa kegiatan belajar mengajar untuk

memperbaiki kondisi pembelajaran yang

dilakukan.

Penelitian dilaksanakan di kelas XI

SMA Negeri 10 Batam. Subyek penelitian

adalah seluruh siswa berjumlah 28 siswa

dengan perincian 11 siswa laki-laki dan 17

siswaperempuan.Pemilihanlokasipenelitian

di SMA Negeri 10 Batam didasarkan atas

pertimbangan perlunya upaya perbaikan

pembelajaran untuk mengatasi kesulitan

siswadalampemahamankonsepmatematika.

Desain penelitian yang digunakan

adalah model Kemmis & McTaggart yang

setiapsiklusnyaterdiridariempattahap,yaitu

(1) perencanaan (planning), (2) tindakan

(acting), (3) observasi (observing), (4) dan

re�leksi (re�lecting) dan penelitian ini

dilaksanakan dalam dua siklus. (Sutarto,

2013). Alur penelitian tindakan kelas yang

digunakandisajikanpadaGambar1.

Gambar1.AlurPenelitianTindakan

Permasalaha

n

Perencanaan

tindakan I

Pelaksanaan

tindakan I

Pengumpulan

data tindakan I

Pengumpulan

data tindakan II

Re�leksi

tindakanI

Perencanaan

tindakan II

Pelaksanaan

tindakan II

Refleksi

tindakan II

Dilanjutkan ke siklus berikutnya

Siklus I

Siklus II

Pengumpulandatadilakukandengan

observasi pembelajaran dan tes. Instrumen

penelit ian yang digunakan meliputi

instrumen pembelajaran dan instrumen

pengukuran pene l i t i an . I n s t rumen

pembelajaranmeliputi rencanapelaksanaan

pembelajaran(RPP),LembarAktivitasSiswa

(LAS), dan skema soal untuk permainan

estafet. Instrumen pengukuran penelitian

meliputi lembar observasi keterlaksanaan

pembelajaran, soal tes untuk mengukur

peningkatanhasilbelajarmatematika.

Analisis data setelah pelaksanaan

berakhir dilakukan re�leksi untuk melihat

kekurangan-kekurangan yang harus di-

perbaiki berdasarkan hasil siklus I. Jika

ternyata di siklus I tujuan belum tercapai

makadilaksanakansiklusIIdengantahapan

yangsamasepertisiklusI,tetapisetelahada

perbaikan-perbaikan dari hasil re�leksi. Jika

hasil evaluasi siklus II sudah memenuhi

indikator keberhasilan maka penelitian

dihentikan tetapi jika ternyata hasil belum

memenuhi indikator keberhasilan maka

dapat dilanjutkan ke siklus selanjutnya

denganmempertimbangankan hasil re�leksi

siklusII.

Page 95: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

94 95

HASILDANPEMBAHASAN

HasilPenelitian

Kegiatan penelitian ini terintegrasi

dalam penelitian tindakan kelas yang

dilakukandalamduasiklusyangsetiapsiklus

terdiri dari empat tahapan: perencanaan,

pelaksanaantindakan,observasidanre�leksi.

SiklusI

Pada tahap perencanaan, peneliti

membuat rancangan pembelajaran dengan

mempersiapkan rencana pelaksanaan

pembelajaran (RPP) dan lembar aktivitas

siswa(LAS)sebagaimediapembelajaran.

Pada tahap pelaksanaan tindakan,

penelitimelakukanreal teaching yangsiklus

pertama dirancang empat kali pertemuan

dengan model pembelajaran kooperatif

denganmediaLAS.Untukpertemuanpertama

berlangsung pada hari Rabu, tanggal 7

Oktober 2015. Tahap awal guru mem-

persiapkanmentalsiswadenganmemberikan

salam dan mengecek kehadiran siswa,

mengkondisikandanmemusatkanperhatian

siswa dengan mengelompokkan siswa yang

terdiri dari 4 orang satu kelompok dan

membagikan LAS 1 kepada masing-masing

kelompokuntukmenggalipengetahuanawal

siswatentangfungsi.

Siswa diminta untuk mengamati

gambar-gambardiagrampanahyangadapada

LAS 1 dan menyuruh siswa mendiskusikan

yangmanakahdarigambar-gambartersebut

yang merupakan fungsi atau relasi biasa.

Setelah15menitgurumemintaduakelompok

untukmenjelaskanhasildiskusinyakedepan

kelasdankelompokyanglainnyamenanggapi

hasilpresentasekelompokyangtampil.Guru

menuntun s i swa untuk sama-sama

menyimpulkande�inisirelasidanfungsi.

Setelahmemahamkan de�inisi fungsi

padapertemuanpertama, gurumenjelaskan

tentangde�inisi sifat-sifatkhusus fungsidan

membagikan LAS 2 kepada siswa pada

pertemuankeduapadahariKamistanggal8

Oktober 2015. Siswa diminta untuk me-

ngamatigambar-gambaryang terdapatpada

LAS2danmendiskusikanyangmanakahdari

gambar-gambar tersebut yang memenuhi

sifatfungsiinjektif,surjektif,maupunbijektif.

Setelah15menit,duakelompoksiswadiminta

untuk mempresentasikan hasil diskusi

kelompoknya dan kelompok lainnya me-

nanggapi.Gurukembalimenuntunsiswapada

pemahamansifat-sifatfungsi.

Pertemuan ketiga siklus I pada hari

Rabu, 14 Oktober 2015 membahas tentang

operasialjabarfungsi.SiswadiberikanLAS3

dan bersama-sama dengan guru men-

diskusikan masalah operasi penjumlahan,

pengurangan,perkaliandanpembagianfungsi

dilanjutkandenganpresentasiolehbeberapa

kelompok dan kelompok yang lain me-

nanggapi. Kegiatan berikutnya dilanjutkan

dengan memberikan tes pada pertemuan

selanjutnya dan memberikan tindak lanjut

berupapenjelasantentangsoal-soaltesyang

tidakdipahamisiswa.

Kegiatanakhirsiklus1adalahre�leksi.

Berdasarkanhasilpengamatanguruterhadap

sikap siswamenunjukkan bahwamasih ada

beberapa siswa yang bermain, kurang aktif

dan tidak mau peduli dengan diskusi

kelompokmaupunhasilpembahasanmateri

yangdijelaskan.Sebagiansiswayanglainnya

yang memiliki pemahaman lebih kurang

bertoleransi terhadap siswa yang masih

kurangpahamsehinggamembuatsiswayang

kurangpahammenjadimalaskarenamerasa

diacuhkan.Halinijugadapatdilihatdarihasil

tesbeberapasiswayangmasihrendahkarena

bersikap acuh tak acuh selama proses

pembelajaran.

lebih terampil dalam mengerjakan tugas

menyelesaikansoal-soalmatematika.“

Oleh karena itu penulis mengangkat

masalah penerapan permainan estafet pada

materi fungsi komposisi yang diharapakan

untukmeningkatkanhasilbelajarsiswa.

METODEPENELITIAN

Penelitian ini merupakan Penelitian

TindakanKelas(PTK),yaitusuatupenelitian

yang dilakukan secara sistematis terhadap

berbagai“aksi”atautindakanyangdilakukan

o leh guru atau pelaku , mula i dar i

perencanaan, sampai dengan penelitian

terhadaptindakannyatadidalamkelasyang

berupa kegiatan belajar mengajar untuk

memperbaiki kondisi pembelajaran yang

dilakukan.

Penelitian dilaksanakan di kelas XI

SMA Negeri 10 Batam. Subyek penelitian

adalah seluruh siswa berjumlah 28 siswa

dengan perincian 11 siswa laki-laki dan 17

siswaperempuan.Pemilihanlokasipenelitian

di SMA Negeri 10 Batam didasarkan atas

pertimbangan perlunya upaya perbaikan

pembelajaran untuk mengatasi kesulitan

siswadalampemahamankonsepmatematika.

Desain penelitian yang digunakan

adalah model Kemmis & McTaggart yang

setiapsiklusnyaterdiridariempattahap,yaitu

(1) perencanaan (planning), (2) tindakan

(acting), (3) observasi (observing), (4) dan

re�leksi (re�lecting) dan penelitian ini

dilaksanakan dalam dua siklus. (Sutarto,

2013). Alur penelitian tindakan kelas yang

digunakandisajikanpadaGambar1.

Gambar1.AlurPenelitianTindakan

Permasalaha

n

Perencanaan

tindakan I

Pelaksanaan

tindakan I

Pengumpulan

data tindakan I

Pengumpulan

data tindakan II

Re�leksi

tindakanI

Perencanaan

tindakan II

Pelaksanaan

tindakan II

Refleksi

tindakan II

Dilanjutkan ke siklus berikutnya

Siklus I

Siklus II

Pengumpulandatadilakukandengan

observasi pembelajaran dan tes. Instrumen

penelit ian yang digunakan meliputi

instrumen pembelajaran dan instrumen

pengukuran pene l i t i an . I n s t rumen

pembelajaranmeliputi rencanapelaksanaan

pembelajaran(RPP),LembarAktivitasSiswa

(LAS), dan skema soal untuk permainan

estafet. Instrumen pengukuran penelitian

meliputi lembar observasi keterlaksanaan

pembelajaran, soal tes untuk mengukur

peningkatanhasilbelajarmatematika.

Analisis data setelah pelaksanaan

berakhir dilakukan re�leksi untuk melihat

kekurangan-kekurangan yang harus di-

perbaiki berdasarkan hasil siklus I. Jika

ternyata di siklus I tujuan belum tercapai

makadilaksanakansiklusIIdengantahapan

yangsamasepertisiklusI,tetapisetelahada

perbaikan-perbaikan dari hasil re�leksi. Jika

hasil evaluasi siklus II sudah memenuhi

indikator keberhasilan maka penelitian

dihentikan tetapi jika ternyata hasil belum

memenuhi indikator keberhasilan maka

dapat dilanjutkan ke siklus selanjutnya

denganmempertimbangankan hasil re�leksi

siklusII.

Page 96: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

96 97

merupakan fungsi yang dapat langsung

memetakan nilai x pada pos ke-1 langsung

menjadihasilpemetaanxpadaposke-3tanpa

melalui pos ke-2 seperti yang digambarkan

padadiagrampanahdibawahini.

f(x) g(x)

Satu fungsi baru

POS 1 masukkan nilai x sembarang

Pos 2 Peta nilai

x dari pos 1

Pos 3 Hasil

peta pos 2

dipetakan

Setelahdidapatsatufungsibaru,guru

menggali pengetahuan siswa dengan me-

ngadakandialog:

Guru : anak-anak bisa dapatkan fungsi

barunya?

Siswa : bisaBu.

Guru : dapatdarimanafungsibarunya?

Siswa : menebak Bu (sebagian kelompok

menjawab), dari coba-coba ma-

sukkan nilai x ke fungsi yang bisa

menghasilkan x pada pos ke-3 Bu,

(jawabkelompoklainnya)

Dari dialog di atas tanpa disadari

siswasudahmampumengkomposisikandua

fungsi menjadi satu fungsi baru walaupun

dengancaracoba-coba.

Guru : anak-anak, tahukah kalian bahwa

hasil fungsibaruyangkaliandapat

tadimerupakanfungsikomposisi?

Siswa :belumbu,komposisidari fungsiapa

bu?

Guru :komposisidariduafungsiawalyang

saya berikan menghasilkan satu

fungsibaruyangkaliandapatkan.

Guru menjelaskan hasil permainan

yangsudahdimainkansiswasecarakonsepdi

kelasdenganmodelpembelajarankooperatif

learningdengantekniktanyajawab.Gurujuga

memvariasikan soal-soal yang diberikan,

misalnya ketika fungsi yang dikomposisikan

merupakan fungsi linear dengan fungsi

kuadrat, fungsi kuadrat dengan kuadrat,

fungsi lineardengan fungsibentukpecahan,

dan bentuk fungsi-fungsi lainnya. Guru juga

memberikanpenjelasantentangmenentukan

fungsipembentukfungsikomposisijikafungsi

komposisi dan salah satu fungsi pem-

bentuknya diketahui. Setelah siswa dirasa

pahamakanmaterifungsikomposisikegiatan

dilanjutkan dengan test kedua dan mem-

berikantindaklanjut.

Hasil observasi pelaksanaan pem-

belajaran menunjukkan bahwa pada proses

pembelajaran hampir seluruh siswa terlibat

aktif dan bertanggung jawab dalam belajar

dikarenakan hasil pemetaan fungsi akan

bernilai benar jika masing-masing siswa di

tiapposkelompokbermaindenganbenar.Jika

salahsatusiswadalamkelompokmelakukan

kesalahan maka akan membuat hasil

pemetaan nilai akhir fungsi menjadi salah.

Sehinggaadaketergantunganhasilantarapos

pertama,keduadanketiga.

Suasana belajar juga menjadi lebih

menyenangkan dan membuat siswa lebih

semangat dalam proses pembelajaran yang

Dari hasil tes dapat dilihat bahwa

kebanyakan siswa mengubah soal yang

diberikandalambentukhimpunanpasangan

berurutan menjadi diagram panah untuk

diselesaikansesuaidengankonsepawalyang

diterima siswa dalammende�inisikan fungsi

dalam bentuk gambar-gambar seperti yang

dibahas pada LAS 1 maupun LAS 2. Pada

operasihitunganaljabarfungsi,siswabanyak

melakukan kesalahan pada penjumlahan

fungsi pecahan, menentukan nilai f(x – 1)

ketika diketahui fungsi f(x) dimana siswa

kebanyakanmensubstitusikan nilai x = 1 ke

dalamfungsif(x),bukandenganmemodi�ikasi

soalyangdiketahuimenjadif(x–1).Padahal

dalampembahasanmaterilain(bukanfungsi)

kebanyakandarisoal-soaltestyangdiberikan

salingberkaitan (sudahdibahas sebelumnya

pada materi lainnya). Namun karena hanya

sebagian siswa yang fokus pada pem-

belajaraankooperatif denganmedia LAS ini,

siswayangtidakambilbagiandalamdiskusi

kelompok tidak dapat menyelesaikan test

sesuaidenganhasilyangdiharapkan.

Dari nilai test siswa yang diperoleh

dalamsiklusIdiperolehnilairata-ratasiswa

40,61 dan ketuntasan kelas yang diperoleh

adalah10,7%dimanasiswayangmemperoleh

nilai tuntashanya3siswa.Dengandemikian

pembelajaran yang dilakukan belum selesai

sesuai dengan indikator keberhasilan yang

telahditetapkandenganbatasnilaituntas67,

sehinggadilanjutkankesiklus2.

SiklusII

Berdasarkan re� leksi s ik lus I

ditemukanadanyakekurangandalammetode

pembelajaran dengan menerapkan pem-

belajaran kooperatif dengan media LAS

karena belum tercapainya indikator

ketercapaian penelitian sehingga penulis

kembali menyusun rencana pelaksanaan

pembelajaran(RPP).UpayaperbaikansiklusI

pada siklus II diperlukan untuk mengatasi

kekurangan pada siklus I, yaitu dengan

memvariasikan pembelajaran kooperatif

secara praktik melalui permainan estafet

dengan tujuan untuk mengakti�kan seluruh

siswa dalam proses kegiatan pembelajaran

yangdiharapkanmampumeningkatkanhasil

belajarsiswa.

TahappelaksanaantindakansiklusII

mulaidilakukanpadahariRabu,21Oktober

2015 dan berakhir pada hari Kamis, 29

Oktober 2015 sebanyak empat kal i

pertemuandenganmetodepermainanestafet

dilanjutkan dengan diskusi kelas dengan

metodetanyajawab.

Dalam permainan estafet, siswa

dibagi menjadi beberapa kelompok belajar

yang tiap kelompok siswa diinstruksikan

untukmembentuk3possepertiposisilomba

lariestafet.

Selanjutnya guru memberikan tong-

kat kertas yang telah ditulis dua fungsi

berbeda kepada siswa yang berdiri di pos

pertama,yaitufungsif(x)danfungsig(x)dan

memintasiswapadapos1untukmenentukan

nilai x sendiri yang akan menjadi domain

fungsi f(x). Selanjutnya tongkat kertas

tersebutditransferkesiswadiposke-2dan

siswadiposke-2dimintamemetakanfungsi

f(x)dengannilaixyangdituliskansiswadipos

ke-1menjadi hasil pada pos ke-2 kemudian

mentransfertongkatkertaskesiswapadapos

ke-3. Siswa di pos ke-3 dimintamemetakan

fungsi g(x) dengan nilai x hasil pemetaan

fungsif(x)darisiswadiposke-2menjadihasil

padaposke-3.Setelahselesaisiswadiminta

kembali pada kelompoknya masing-masing

untukberdiskusibersamamenentukansuatu

fungsi baru (bukan f(x) dan g(x)) yang

Page 97: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

96 97

merupakan fungsi yang dapat langsung

memetakan nilai x pada pos ke-1 langsung

menjadihasilpemetaanxpadaposke-3tanpa

melalui pos ke-2 seperti yang digambarkan

padadiagrampanahdibawahini.

f(x) g(x)

Satu fungsi baru

POS 1 masukkan nilai x sembarang

Pos 2 Peta nilai

x dari pos 1

Pos 3 Hasil

peta pos 2

dipetakan

Setelahdidapatsatufungsibaru,guru

menggali pengetahuan siswa dengan me-

ngadakandialog:

Guru : anak-anak bisa dapatkan fungsi

barunya?

Siswa : bisaBu.

Guru : dapatdarimanafungsibarunya?

Siswa : menebak Bu (sebagian kelompok

menjawab), dari coba-coba ma-

sukkan nilai x ke fungsi yang bisa

menghasilkan x pada pos ke-3 Bu,

(jawabkelompoklainnya)

Dari dialog di atas tanpa disadari

siswasudahmampumengkomposisikandua

fungsi menjadi satu fungsi baru walaupun

dengancaracoba-coba.

Guru : anak-anak, tahukah kalian bahwa

hasil fungsibaruyangkaliandapat

tadimerupakanfungsikomposisi?

Siswa :belumbu,komposisidari fungsiapa

bu?

Guru :komposisidariduafungsiawalyang

saya berikan menghasilkan satu

fungsibaruyangkaliandapatkan.

Guru menjelaskan hasil permainan

yangsudahdimainkansiswasecarakonsepdi

kelasdenganmodelpembelajarankooperatif

learningdengantekniktanyajawab.Gurujuga

memvariasikan soal-soal yang diberikan,

misalnya ketika fungsi yang dikomposisikan

merupakan fungsi linear dengan fungsi

kuadrat, fungsi kuadrat dengan kuadrat,

fungsi lineardengan fungsibentukpecahan,

dan bentuk fungsi-fungsi lainnya. Guru juga

memberikanpenjelasantentangmenentukan

fungsipembentukfungsikomposisijikafungsi

komposisi dan salah satu fungsi pem-

bentuknya diketahui. Setelah siswa dirasa

pahamakanmaterifungsikomposisikegiatan

dilanjutkan dengan test kedua dan mem-

berikantindaklanjut.

Hasil observasi pelaksanaan pem-

belajaran menunjukkan bahwa pada proses

pembelajaran hampir seluruh siswa terlibat

aktif dan bertanggung jawab dalam belajar

dikarenakan hasil pemetaan fungsi akan

bernilai benar jika masing-masing siswa di

tiapposkelompokbermaindenganbenar.Jika

salahsatusiswadalamkelompokmelakukan

kesalahan maka akan membuat hasil

pemetaan nilai akhir fungsi menjadi salah.

Sehinggaadaketergantunganhasilantarapos

pertama,keduadanketiga.

Suasana belajar juga menjadi lebih

menyenangkan dan membuat siswa lebih

semangat dalam proses pembelajaran yang

Dari hasil tes dapat dilihat bahwa

kebanyakan siswa mengubah soal yang

diberikandalambentukhimpunanpasangan

berurutan menjadi diagram panah untuk

diselesaikansesuaidengankonsepawalyang

diterima siswa dalammende�inisikan fungsi

dalam bentuk gambar-gambar seperti yang

dibahas pada LAS 1 maupun LAS 2. Pada

operasihitunganaljabarfungsi,siswabanyak

melakukan kesalahan pada penjumlahan

fungsi pecahan, menentukan nilai f(x – 1)

ketika diketahui fungsi f(x) dimana siswa

kebanyakanmensubstitusikan nilai x = 1 ke

dalamfungsif(x),bukandenganmemodi�ikasi

soalyangdiketahuimenjadif(x–1).Padahal

dalampembahasanmaterilain(bukanfungsi)

kebanyakandarisoal-soaltestyangdiberikan

salingberkaitan (sudahdibahas sebelumnya

pada materi lainnya). Namun karena hanya

sebagian siswa yang fokus pada pem-

belajaraankooperatif denganmedia LAS ini,

siswayangtidakambilbagiandalamdiskusi

kelompok tidak dapat menyelesaikan test

sesuaidenganhasilyangdiharapkan.

Dari nilai test siswa yang diperoleh

dalamsiklusIdiperolehnilairata-ratasiswa

40,61 dan ketuntasan kelas yang diperoleh

adalah10,7%dimanasiswayangmemperoleh

nilai tuntashanya3siswa.Dengandemikian

pembelajaran yang dilakukan belum selesai

sesuai dengan indikator keberhasilan yang

telahditetapkandenganbatasnilaituntas67,

sehinggadilanjutkankesiklus2.

SiklusII

Berdasarkan re� leksi s ik lus I

ditemukanadanyakekurangandalammetode

pembelajaran dengan menerapkan pem-

belajaran kooperatif dengan media LAS

karena belum tercapainya indikator

ketercapaian penelitian sehingga penulis

kembali menyusun rencana pelaksanaan

pembelajaran(RPP).UpayaperbaikansiklusI

pada siklus II diperlukan untuk mengatasi

kekurangan pada siklus I, yaitu dengan

memvariasikan pembelajaran kooperatif

secara praktik melalui permainan estafet

dengan tujuan untuk mengakti�kan seluruh

siswa dalam proses kegiatan pembelajaran

yangdiharapkanmampumeningkatkanhasil

belajarsiswa.

TahappelaksanaantindakansiklusII

mulaidilakukanpadahariRabu,21Oktober

2015 dan berakhir pada hari Kamis, 29

Oktober 2015 sebanyak empat kal i

pertemuandenganmetodepermainanestafet

dilanjutkan dengan diskusi kelas dengan

metodetanyajawab.

Dalam permainan estafet, siswa

dibagi menjadi beberapa kelompok belajar

yang tiap kelompok siswa diinstruksikan

untukmembentuk3possepertiposisilomba

lariestafet.

Selanjutnya guru memberikan tong-

kat kertas yang telah ditulis dua fungsi

berbeda kepada siswa yang berdiri di pos

pertama,yaitufungsif(x)danfungsig(x)dan

memintasiswapadapos1untukmenentukan

nilai x sendiri yang akan menjadi domain

fungsi f(x). Selanjutnya tongkat kertas

tersebutditransferkesiswadiposke-2dan

siswadiposke-2dimintamemetakanfungsi

f(x)dengannilaixyangdituliskansiswadipos

ke-1menjadi hasil pada pos ke-2 kemudian

mentransfertongkatkertaskesiswapadapos

ke-3. Siswa di pos ke-3 dimintamemetakan

fungsi g(x) dengan nilai x hasil pemetaan

fungsif(x)darisiswadiposke-2menjadihasil

padaposke-3.Setelahselesaisiswadiminta

kembali pada kelompoknya masing-masing

untukberdiskusibersamamenentukansuatu

fungsi baru (bukan f(x) dan g(x)) yang

Page 98: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

98 99

No.UrutSiswa

NilaiSiklus1

Ket

NilaiSiklus2

Ket

27 40 TidakTuntas

68 Tuntas

28 30 TidakTuntas

50 TidakTuntas

JlhNilai 1147 1689

Rata-rata

40,96 60,32

KetuntasanBljr

10,71% 57,14%

Sedangkan untuk perbandingan keaktifan

siswa dalam kegiatan pembelajaran yang

diperoleh melalui pengamatan guru pada

siklus 1 dan siklus 2 terlihat pada tabel

dibawahini.

Tabel2.PerbandinganKeaktifanSiswa

Kegiatan Siklus1 Siklus2

KeaktifanSiswa 61.97 83.55

FokusSiswa 73.61 91.07

Kerjasama 65.77 80.35

TanggungJawab 69.73 92.85

Sedangkan untuk hasil tes siswa disiklus 2

tergambar bahwa siswa telah mampu

mengkomposisikanduafungsiberbedayaitu

dengan memasukkan fungsi yang satu ke

fungsi lainnya menjadi satu fungsi baru,

kesalahanyangdilakukansiswaterletakpada

operasialjabarfungsinyayangdipelajaripada

siklus I. Sehingga siswapahamakankonsep

komposisi fungsi namum masih perlu

diperbaikipenanamankonsepoperasialjabar

fungsinya.

Pembahasan

Berdasarkan hasil analisis data

ditemukanbahwadiawalkegiatanpenelitian

tidakadapenyegaransepertipermainanyang

menyenangkan atau sejenisnya yang di-

berikan diawal sehingga selama proses

belajarmengajarberlangsungsiswamenjadi

jenuh dan dilanjutkan dengan test yang

memberikan hasil yang tidak tuntas karena

tidak fokusnya sebagian siswa pada pem-

belajaran.Padakegiatanpembelajarankedua

ada penyegaran bagi siswa dalam bentuk

permainan sehingga pada saat guru

menjelaskan konsep di kelas secara tanya

jawab, siswa sudah dapat memfokuskan

perhatian pada proses pembelajaran untuk

memaknai praktek permainan yang baru

dilakukan siswa. Hal ini juga diungkapkan

olehImandanJawahir(2011)bahwahalyang

sangat menentukan tingkat motivasi siswa

adalah pembelajaran yang menyenangkan,

yaitupembelajaranyangdapatdinikmatidan

mengasyikkan siswa. Pembelajaran yang

menyenangkanmerupakanupayapenciptaan

lingkunganbelajar yangkondusif/bermakna

yang mampu memberikan siswa ke-

terampilan, pengetahuan dan sikap untuk

hidup.

SIMPULANSARAN

SIMPULAN

Berdasarkanhasilpenelitianini,maka

dapat disimpulkan bahwa penerapan

pembelajaran fungsi komposisi dengan

permainanestafetpadasiswakelasXISMAN

10 Batam dapatmeningkatkan hasil belajar

siswa,yaitupadasiklusIdengannilairata-rata

40,96meningkatdisiklusIIdenganrata-rata

menjadi 60,32 dengan persentase pening-

katan sebesar 19,35%. Selainmeningkatkan

hasilbelajarmetodepermainaninijugadapat

meningkatkankeaktifansiswa.

Saran

Selanjutnya dapat disarankan agar

teman sejawat guru matematika dapat

menerapkan metode permainan atau

melakukan penyegaran sebelum memahami

konsep materi matematika yang relatif

dapatdilihatdaridialog:

Guru : Bagaimana anak-anak, paham cara

mendapatkanfungsikomposisinya?

Siswa:pahamBu!

Guru : Lebih senang yang mana, belajar

sambil bermain atau belajar seperti

biasanyakita?

Siswa : Lebih senang seperti ini Bu, lebih

pahamdanmudah.

Hasil re�leksi pembelajaran me-

nunjukkantemuanpenelitian,yaitu:1)Dalam

melaksanakan pembelajaran dengan

permainan estafet, guru lebihmudah dalam

menanamkan konsep fungsi komposisi dan

siswa juga lebih mudah memahaminya; 2)

Dengan mengkondisikan kelas dengan

suasana yang lebih menyenangkan, hampir

seluruhsiswaberminatuntukberpartisipasi

aktif dan bertanggung jawab dalam proses

pembelajaran; 3) Pembelajaran dengan

permainanmenyitawaktuyanglebihbanyak

daripadapembelajaranpadasiklusIdengan

bantuan media LAS, namun penanaman

konsep yang diterima siswa tentang materi

fungsi lebih baik dari pembelajaran pada

siklusI;4)Beberapasiswamengusulkanagar

pertemuan berikutnya dapat divariasikan

dengan permainan seperti yang dilakukan

pada siklus II agar pembelajaran tidak kaku

danmonoton sehingga ada penyegaran bagi

siswadalambelajarmatematika;5)Darihasil

tesyangdiperolehsiswapadasiklusIIdidapat

nilairata-ratasiswa60,32.Nilairata-rata ini

meningkat dengan persentase peningkatan

rata-rata sebesar 19,4%dari hasil test pada

siklusI,dengantingkatketuntasankelasyang

diperoleh meningkat sebesar 57,14%.

Walaupun hasil peningkatan ini belum

mencapai indikator ketuntasan yang

ditetapkan, namun sudah ada peningkatan

hasil test siswa dimana siswa yang tuntas

sebanyak16siswa.

Berikutperbandinganhasiltessiswa

padasiklus1dansiklus2.

Tabel1.HasilTesSiswaSiklus1danSiklus2

No.UrutSiswa

NilaiSiklus1

Ket

NilaiSiklus2

Ket

1 50 TidakTuntas

70 Tuntas

2 35 TidakTuntas

50 TidakTuntas

3 70 Tuntas 80 Tuntas

4 30 TidakTuntas

45 TidakTuntas

5 50 TidakTuntas

70 Tuntas

6 45 TidakTuntas

70 Tuntas

7 60 TidakTuntas

70 Tuntas

8 30 TidakTuntas

40 TidakTuntas

9 30 TidakTuntas

45 TidakTuntas

10 50 TidakTuntas

70 Tuntas

11 30 TidakTuntas

50 TidakTuntas

12 20 TidakTuntas

50 TidakTuntas

13 67 Tuntas 80 Tuntas

14 50 TidakTuntas

70 Tuntas

15 20 TidakTuntas

40 TidakTuntas

16 35 TidakTuntas

67 Tuntas

17 25 TidakTuntas

40 TidakTuntas

18 70 Tuntas 75 Tuntas

19 45 TidakTuntas

67 Tuntas

20 20 TidakTuntas

50 TidakTuntas

21 60 TidakTuntas

80 Tuntas

22 20 TidakTuntas

40 TidakTuntas

23 35 TidakTuntas

67 Tuntas

24 60 TidakTuntas

70 Tuntas

25 25 TidakTuntas

40 TidakTuntas

26 45 TidakTuntas

75 Tuntas

Page 99: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

98 99

No.UrutSiswa

NilaiSiklus1

Ket

NilaiSiklus2

Ket

27 40 TidakTuntas

68 Tuntas

28 30 TidakTuntas

50 TidakTuntas

JlhNilai 1147 1689

Rata-rata

40,96 60,32

KetuntasanBljr

10,71% 57,14%

Sedangkan untuk perbandingan keaktifan

siswa dalam kegiatan pembelajaran yang

diperoleh melalui pengamatan guru pada

siklus 1 dan siklus 2 terlihat pada tabel

dibawahini.

Tabel2.PerbandinganKeaktifanSiswa

Kegiatan Siklus1 Siklus2

KeaktifanSiswa 61.97 83.55

FokusSiswa 73.61 91.07

Kerjasama 65.77 80.35

TanggungJawab 69.73 92.85

Sedangkan untuk hasil tes siswa disiklus 2

tergambar bahwa siswa telah mampu

mengkomposisikanduafungsiberbedayaitu

dengan memasukkan fungsi yang satu ke

fungsi lainnya menjadi satu fungsi baru,

kesalahanyangdilakukansiswaterletakpada

operasialjabarfungsinyayangdipelajaripada

siklus I. Sehingga siswapahamakankonsep

komposisi fungsi namum masih perlu

diperbaikipenanamankonsepoperasialjabar

fungsinya.

Pembahasan

Berdasarkan hasil analisis data

ditemukanbahwadiawalkegiatanpenelitian

tidakadapenyegaransepertipermainanyang

menyenangkan atau sejenisnya yang di-

berikan diawal sehingga selama proses

belajarmengajarberlangsungsiswamenjadi

jenuh dan dilanjutkan dengan test yang

memberikan hasil yang tidak tuntas karena

tidak fokusnya sebagian siswa pada pem-

belajaran.Padakegiatanpembelajarankedua

ada penyegaran bagi siswa dalam bentuk

permainan sehingga pada saat guru

menjelaskan konsep di kelas secara tanya

jawab, siswa sudah dapat memfokuskan

perhatian pada proses pembelajaran untuk

memaknai praktek permainan yang baru

dilakukan siswa. Hal ini juga diungkapkan

olehImandanJawahir(2011)bahwahalyang

sangat menentukan tingkat motivasi siswa

adalah pembelajaran yang menyenangkan,

yaitupembelajaranyangdapatdinikmatidan

mengasyikkan siswa. Pembelajaran yang

menyenangkanmerupakanupayapenciptaan

lingkunganbelajar yangkondusif/bermakna

yang mampu memberikan siswa ke-

terampilan, pengetahuan dan sikap untuk

hidup.

SIMPULANSARAN

SIMPULAN

Berdasarkanhasilpenelitianini,maka

dapat disimpulkan bahwa penerapan

pembelajaran fungsi komposisi dengan

permainanestafetpadasiswakelasXISMAN

10 Batam dapatmeningkatkan hasil belajar

siswa,yaitupadasiklusIdengannilairata-rata

40,96meningkatdisiklusIIdenganrata-rata

menjadi 60,32 dengan persentase pening-

katan sebesar 19,35%. Selainmeningkatkan

hasilbelajarmetodepermainaninijugadapat

meningkatkankeaktifansiswa.

Saran

Selanjutnya dapat disarankan agar

teman sejawat guru matematika dapat

menerapkan metode permainan atau

melakukan penyegaran sebelum memahami

konsep materi matematika yang relatif

dapatdilihatdaridialog:

Guru : Bagaimana anak-anak, paham cara

mendapatkanfungsikomposisinya?

Siswa:pahamBu!

Guru : Lebih senang yang mana, belajar

sambil bermain atau belajar seperti

biasanyakita?

Siswa : Lebih senang seperti ini Bu, lebih

pahamdanmudah.

Hasil re�leksi pembelajaran me-

nunjukkantemuanpenelitian,yaitu:1)Dalam

melaksanakan pembelajaran dengan

permainan estafet, guru lebihmudah dalam

menanamkan konsep fungsi komposisi dan

siswa juga lebih mudah memahaminya; 2)

Dengan mengkondisikan kelas dengan

suasana yang lebih menyenangkan, hampir

seluruhsiswaberminatuntukberpartisipasi

aktif dan bertanggung jawab dalam proses

pembelajaran; 3) Pembelajaran dengan

permainanmenyitawaktuyanglebihbanyak

daripadapembelajaranpadasiklusIdengan

bantuan media LAS, namun penanaman

konsep yang diterima siswa tentang materi

fungsi lebih baik dari pembelajaran pada

siklusI;4)Beberapasiswamengusulkanagar

pertemuan berikutnya dapat divariasikan

dengan permainan seperti yang dilakukan

pada siklus II agar pembelajaran tidak kaku

danmonoton sehingga ada penyegaran bagi

siswadalambelajarmatematika;5)Darihasil

tesyangdiperolehsiswapadasiklusIIdidapat

nilairata-ratasiswa60,32.Nilairata-rata ini

meningkat dengan persentase peningkatan

rata-rata sebesar 19,4%dari hasil test pada

siklusI,dengantingkatketuntasankelasyang

diperoleh meningkat sebesar 57,14%.

Walaupun hasil peningkatan ini belum

mencapai indikator ketuntasan yang

ditetapkan, namun sudah ada peningkatan

hasil test siswa dimana siswa yang tuntas

sebanyak16siswa.

Berikutperbandinganhasiltessiswa

padasiklus1dansiklus2.

Tabel1.HasilTesSiswaSiklus1danSiklus2

No.UrutSiswa

NilaiSiklus1

Ket

NilaiSiklus2

Ket

1 50 TidakTuntas

70 Tuntas

2 35 TidakTuntas

50 TidakTuntas

3 70 Tuntas 80 Tuntas

4 30 TidakTuntas

45 TidakTuntas

5 50 TidakTuntas

70 Tuntas

6 45 TidakTuntas

70 Tuntas

7 60 TidakTuntas

70 Tuntas

8 30 TidakTuntas

40 TidakTuntas

9 30 TidakTuntas

45 TidakTuntas

10 50 TidakTuntas

70 Tuntas

11 30 TidakTuntas

50 TidakTuntas

12 20 TidakTuntas

50 TidakTuntas

13 67 Tuntas 80 Tuntas

14 50 TidakTuntas

70 Tuntas

15 20 TidakTuntas

40 TidakTuntas

16 35 TidakTuntas

67 Tuntas

17 25 TidakTuntas

40 TidakTuntas

18 70 Tuntas 75 Tuntas

19 45 TidakTuntas

67 Tuntas

20 20 TidakTuntas

50 TidakTuntas

21 60 TidakTuntas

80 Tuntas

22 20 TidakTuntas

40 TidakTuntas

23 35 TidakTuntas

67 Tuntas

24 60 TidakTuntas

70 Tuntas

25 25 TidakTuntas

40 TidakTuntas

26 45 TidakTuntas

75 Tuntas

Page 100: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

100 101

UPAYAPENINGKATANPENERAPANPRINSIP-PRINSIPPENILAIANMELALUIBIMBINGAN

LANGSUNGPADAGURUSDNEGERI001MORO

Syafrizal*

Abstrak: Tujuan penelitian ini yaitu untuk meningkatkan kemampuan profesional guru dalam bidangmenilaihasilbelajarsiswaSD001Moro.PenelitianinimenggunakanrancanganPenelitianTindakanSekolah(PTS).SubjekpenelitianadalahguruPNS,GuruGTTdenganjumlah14orang.Hasilpenelitianyangdidapatyaitu:1)TeknikpenilaiandalamRPP100%dibuatolehgurumasing-masing(pribadi);2)DalammemilihaspekKognitif(pengetahuan)guruyangsudahmemahami85%danguruyangbelummenguasai15%;3)Dalammemilihaspekpsikomotor(keterampilan)77%gurumenggunakaninstrumenunjukkerjadan23%guru yang belum menggunakannya; 4) Pemahaman guru tentang teknik non tes (angket) 62%; 5)Pemahamangurutentangprinsipberkesinambungandalampenilaianhasilbelajarhanya69%.Kesimpulanpenelitian ini adalah sebagaiberikut:1)Denganpenerapanprinsip-prinsippenilaiandi SDN001Moro,kemampuanguru-gurudalammelaksanakanpenilaianhasilbelajarsiswabanyakmengalamiperubahankearahyanglebihbaikterutamadalampemahamantentangprinsip-prinsippenilaian;2)Denganmemahamiberbagaiteknikpenilaianguru-gurudiSDN001Morosudahdapatmenerapkanberbagaiteknikpenilaiandalamprosespembelajarandikelasmasing-masing.

KataKunci:Prinsip-PrinsipPenilaian,BimbinganLangsung

PENDAHULUAN

Dalam undang-undang Repubik

Indonesia Nomor 14 Tahun 2005 tentang

gurudandosendinyatakanguruadalahPen-

didik Profesional dengan tugas utama

mendidik, mengajar, membimbing, me-

ngarahkan, melatih, menilai dan menge-

valuasipesertadidik padapendidikananak

usiadinijalurpendidikanformal,pendidikan

dasar dan pendidikan menengah (Bab.I

Ketentuanumumpasal1ayat1).

Dalam melaksanakan tugas kepro-

fesionalan,guruberkewajibanmerencanakan

pembelajaran, melaksanakan proses pem-

belajaran yang bermutu, serta menilai dan

mengevaluasi hasil pembelajaran (Bab. IV

Pasal20Ayata).

Dari pernyataan diatas tampak jelas

bahwasalahsatutugasutamadankewajiban

seorangguruadalahmelaksanakanpenilaian

terhadap peserta didik yang ada di-

sekolahnya. Ada beberapa prinsip penilaian

yang dapat digunakan agar penilaian yang

guru lakukan benar-benar dapat memberi

gambaran yang sebenarnya tentang pen-

capaianhasilbelajarsiswa.

Penilaianyangdilakukanguruharus

berfungsi untuk mengukur ketercapaian

siswa dalam pencapaian kompetensi,

penilaian yang dilakukan guru harus dapat

mengukur apa yang seharusnya diukur.

Penilaian yang dilakukan guru harus adil

untuk semua siswa. Dalam melaksanakan

penilaian guru harus dapat menjaga

objektivitas proses dan hasil penilaian.

Penilaianharusterencana,bertahap, teratur,

terus-menerus dan berkesinambungan.

Penilaian yang dilakukan harus mampu

menilai keseluruhan kompetensi yang

terdapat dalam kurikulum yang meliputi

ranahkognitif,afektifdanpsikomotor.

Keputusan hasil penilaian jelas bagi

pihak-pihak yang berkepentingan serta

memberi gambaran mengenai tingkat

pencapaian hasil belajar siswa, keunggulan

dan kelemahan siswa, minat serta potensi

siswadalammencapaikompetensiyangtelah

ditetapkan. Standar Nasional Pendidikan

mengungkapkan bahwa “penilaian hasil

abstrak dan sulit dipahami. Metode pem-

belajaran tersebut jugadapatdimamfaatkan

untuk meningkatkan kemampuan siswa

dalammemahamikonsepmatematika.

DAFTARPUSTAKA

Gunawa t i , E rna , 2013 . Pene rapanPembelajaran Kooperative Tipe STADPadaOperasiAljabarBerbantuanMediaUbin Aljabar Berdasarkan PengalamanKegiatan Lesson Study. ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Marlina, 2013. Penerapan KooperativeL e a r n i n g T i p e S TA D U n t u kMeningkatkan Motivasi dan HasilBelajar Pada Pecahan Senilai MelaluiPenggunaan Pita Bilangan. ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Hikmah, Helmi N, 2013. Penerapan ModelPembelajaran Cooperative Tipe STADDengan Media Manipulative UntukMenentukan Rumus Volume BangunRuangSisiDatardiKelasVIIISMPNegeri2 Tanah Grogot.Jurnal TEQIP EdisiNovember 2013. Malang: UniversitasNegeriMalang.

Risliana, 2013. Meningkatkan Hasil BelajarMatematikaPadaMateriBangunRuangMelaluiModelKooperatifTipeNumberedHeadTogether(NHT)SiswaKelasIVSDN001 Kuaro Kab. Paser Tahun Pelajaran2012/2013.ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Sopiah,Siti,2013.PenerapanModelKooperatifTipeTwoStayTwoStray (TSTS)UntukMeningkatkanPemahamanSiswaDalamMenemukan Rumus Luas Trapesium diKelasVSD.ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

SutartodanKadiyo,2013.BimbinganPraktisDalam Penelitian Tindakan Kelas. CV.Jakarta:KemilauIlmuSemesta

Subanji, 2013. Pembelajaran MatematikaKreatifdanInovatif.Malang:UniversitasNegeriMalang(UMPRESS)

Iman,PangkudanJawahir,2011.PeningkatanMotivasi danHasil BelajarMatematikaMelalui Pembelajaran Remedial YangMenyenangkan.JurnalTEQIP2011EdisiTahunIINomor2.

Purwanto, 2011. Pembelajaran ModelCooperatifLearningpadaSiswaKelasVISD N 007 Waru Kabupaten PenajamPaserUtaraImplementasiLessonStudy.JurnalTEQIP2011EdisiTahunIINomorI.

Subanji, 2009. Pembelajaran MatematikaKreatifdanInovatif.Malang:UniversitasNegeriMalang(UMPRESS)

Slavin,RobertE,2008.CooperativeLearningTeori,RisetdanPraktik.Bandung:NusaMedia.

Page 101: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

100 101

UPAYAPENINGKATANPENERAPANPRINSIP-PRINSIPPENILAIANMELALUIBIMBINGAN

LANGSUNGPADAGURUSDNEGERI001MORO

Syafrizal*

Abstrak: Tujuan penelitian ini yaitu untuk meningkatkan kemampuan profesional guru dalam bidangmenilaihasilbelajarsiswaSD001Moro.PenelitianinimenggunakanrancanganPenelitianTindakanSekolah(PTS).SubjekpenelitianadalahguruPNS,GuruGTTdenganjumlah14orang.Hasilpenelitianyangdidapatyaitu:1)TeknikpenilaiandalamRPP100%dibuatolehgurumasing-masing(pribadi);2)DalammemilihaspekKognitif(pengetahuan)guruyangsudahmemahami85%danguruyangbelummenguasai15%;3)Dalammemilihaspekpsikomotor(keterampilan)77%gurumenggunakaninstrumenunjukkerjadan23%guru yang belum menggunakannya; 4) Pemahaman guru tentang teknik non tes (angket) 62%; 5)Pemahamangurutentangprinsipberkesinambungandalampenilaianhasilbelajarhanya69%.Kesimpulanpenelitian ini adalah sebagaiberikut:1)Denganpenerapanprinsip-prinsippenilaiandi SDN001Moro,kemampuanguru-gurudalammelaksanakanpenilaianhasilbelajarsiswabanyakmengalamiperubahankearahyanglebihbaikterutamadalampemahamantentangprinsip-prinsippenilaian;2)Denganmemahamiberbagaiteknikpenilaianguru-gurudiSDN001Morosudahdapatmenerapkanberbagaiteknikpenilaiandalamprosespembelajarandikelasmasing-masing.

KataKunci:Prinsip-PrinsipPenilaian,BimbinganLangsung

PENDAHULUAN

Dalam undang-undang Repubik

Indonesia Nomor 14 Tahun 2005 tentang

gurudandosendinyatakanguruadalahPen-

didik Profesional dengan tugas utama

mendidik, mengajar, membimbing, me-

ngarahkan, melatih, menilai dan menge-

valuasipesertadidik padapendidikananak

usiadinijalurpendidikanformal,pendidikan

dasar dan pendidikan menengah (Bab.I

Ketentuanumumpasal1ayat1).

Dalam melaksanakan tugas kepro-

fesionalan,guruberkewajibanmerencanakan

pembelajaran, melaksanakan proses pem-

belajaran yang bermutu, serta menilai dan

mengevaluasi hasil pembelajaran (Bab. IV

Pasal20Ayata).

Dari pernyataan diatas tampak jelas

bahwasalahsatutugasutamadankewajiban

seorangguruadalahmelaksanakanpenilaian

terhadap peserta didik yang ada di-

sekolahnya. Ada beberapa prinsip penilaian

yang dapat digunakan agar penilaian yang

guru lakukan benar-benar dapat memberi

gambaran yang sebenarnya tentang pen-

capaianhasilbelajarsiswa.

Penilaianyangdilakukanguruharus

berfungsi untuk mengukur ketercapaian

siswa dalam pencapaian kompetensi,

penilaian yang dilakukan guru harus dapat

mengukur apa yang seharusnya diukur.

Penilaian yang dilakukan guru harus adil

untuk semua siswa. Dalam melaksanakan

penilaian guru harus dapat menjaga

objektivitas proses dan hasil penilaian.

Penilaianharusterencana,bertahap, teratur,

terus-menerus dan berkesinambungan.

Penilaian yang dilakukan harus mampu

menilai keseluruhan kompetensi yang

terdapat dalam kurikulum yang meliputi

ranahkognitif,afektifdanpsikomotor.

Keputusan hasil penilaian jelas bagi

pihak-pihak yang berkepentingan serta

memberi gambaran mengenai tingkat

pencapaian hasil belajar siswa, keunggulan

dan kelemahan siswa, minat serta potensi

siswadalammencapaikompetensiyangtelah

ditetapkan. Standar Nasional Pendidikan

mengungkapkan bahwa “penilaian hasil

abstrak dan sulit dipahami. Metode pem-

belajaran tersebut jugadapatdimamfaatkan

untuk meningkatkan kemampuan siswa

dalammemahamikonsepmatematika.

DAFTARPUSTAKA

Gunawa t i , E rna , 2013 . Pene rapanPembelajaran Kooperative Tipe STADPadaOperasiAljabarBerbantuanMediaUbin Aljabar Berdasarkan PengalamanKegiatan Lesson Study. ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Marlina, 2013. Penerapan KooperativeL e a r n i n g T i p e S TA D U n t u kMeningkatkan Motivasi dan HasilBelajar Pada Pecahan Senilai MelaluiPenggunaan Pita Bilangan. ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Hikmah, Helmi N, 2013. Penerapan ModelPembelajaran Cooperative Tipe STADDengan Media Manipulative UntukMenentukan Rumus Volume BangunRuangSisiDatardiKelasVIIISMPNegeri2 Tanah Grogot.Jurnal TEQIP EdisiNovember 2013. Malang: UniversitasNegeriMalang.

Risliana, 2013. Meningkatkan Hasil BelajarMatematikaPadaMateriBangunRuangMelaluiModelKooperatifTipeNumberedHeadTogether(NHT)SiswaKelasIVSDN001 Kuaro Kab. Paser Tahun Pelajaran2012/2013.ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

Sopiah,Siti,2013.PenerapanModelKooperatifTipeTwoStayTwoStray (TSTS)UntukMeningkatkanPemahamanSiswaDalamMenemukan Rumus Luas Trapesium diKelasVSD.ProsidingSeminarNasionalTEQIP2013.Malang:UniversitasNegeriMalang.

SutartodanKadiyo,2013.BimbinganPraktisDalam Penelitian Tindakan Kelas. CV.Jakarta:KemilauIlmuSemesta

Subanji, 2013. Pembelajaran MatematikaKreatifdanInovatif.Malang:UniversitasNegeriMalang(UMPRESS)

Iman,PangkudanJawahir,2011.PeningkatanMotivasi danHasil BelajarMatematikaMelalui Pembelajaran Remedial YangMenyenangkan.JurnalTEQIP2011EdisiTahunIINomor2.

Purwanto, 2011. Pembelajaran ModelCooperatifLearningpadaSiswaKelasVISD N 007 Waru Kabupaten PenajamPaserUtaraImplementasiLessonStudy.JurnalTEQIP2011EdisiTahunIINomorI.

Subanji, 2009. Pembelajaran MatematikaKreatifdanInovatif.Malang:UniversitasNegeriMalang(UMPRESS)

Slavin,RobertE,2008.CooperativeLearningTeori,RisetdanPraktik.Bandung:NusaMedia.

Page 102: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

102 103

informasi untuk membuat keputusan.

Penilaian merupakan serangkaian kegiatan

untuk memperoleh, menganalisis dan

menafsirkan data tentang proses dan hasil

belajar peserta didik yang dilakukan secara

sistematisdanberkesinambungan sehingga

menjadi informasi yang bermakna dalam

pengambilankeputusan.

Hasil belajar merupakan prestasi

belajarpesertadidiksecarakeseluruhan,yang

menjadi indikator kompetensi dasar dan

derajat perubahan perilaku yang ber-

sangkutan.Penilaianhasilbelajarmerupakan

suatu kegiatan untuk mengukur perubahan

perilakuyang telah terjadipadadiripeserta

didik. Pada umumnya hasil belajar akan

memberikanpengaruhdalamduabentuk:1)

Peserta didik akan mempunyai prespektif

terhadap kekuatan dan kelemahan atas

perilaku yang diinginkan; 2) Mereka men-

dapatkanbahwaperilakuyangdiinginkanitu

telah meningkat setahap atau dua tahap,

sehingga timbul lagi kesenjangan antara

penampilan perilaku sekarang dengan

perilakuyangdiinginkan.

Penilaian hasil belajar oleh pendidik

dapat dilakukan terhadap program, proses

danhasilbelajar.Penilaianprogrambertujuan

untuk menilai efektivitas program yang

dilaksanakan. Penilaian proses bertujuan

untuk mengetahui aktivitas dan partisipasi

pesertadidikdalampembelajaran.Penilaian

hasil bertujuan untuk mengetahui hasil

belajar atau pembentukan kompetensi

pesertadidik.

Seluruh penilaian ini dilakukan oleh

guru untukmengetahui kemajuan dan hasil

belajar peserta didik,mendiagnosa kegiatan

belajar, memberikan umpan balik untuk

memperbaiki proses pembelajaran, dan

menentukan kenaikan kelas bagi setiap

pesertadidik.

Sehubungan dengan penilaian

pembelajaran, Moekijat (1992:69) menge-

mukakanteknikpenilaianpembelajaran,yang

mencakupaspekpengetahuan,keterampilan

dansikapsebagaiberikut:1)Penilaianbelajar

pengetahuan dapat dilakukan dengan ujian

tulis, lisan dan daftar isian pertanyaan; 2)

Penilaian belajar keterampilan, dapat

dilakukan dengan ujian praktek, analisis

keterampilan dan analisis tugas. Serta

penilaian oleh peserta didik sendiri; 3)

Penilaian belajar sikap, dapat dilakukan

dengan daftar isian, sikap dari diri sendiri,

daftar isian sikap yang disesuaikan dengan

tujuan program dan Sekala Deferensial

Sematik(SDS).

Prinsip-prinsipPenilaian

Agar penilaian yang guru lakukan

benar-benardapatmemberigambaranyang

sebenarnyatentangpencapaianhasilbelajar

siswamakadalammelakukanpenilaianguru

perlu memperhatikan prinsip-prinsip

penilaian, Adi Suryanto, dkk (2012) me-

ngemukakana)Berorientasipadapencapaian

kompetensi penilaian yang guru lakukan

harus berfungsi untuk mengukur ke-

tercapaian siswa dalam pencapaian kom-

petensi yang telah ditetapkan dalam

kurikulum; b) Valid, penilaian yang guru

lakukan harus dapat mengukur apa yang

seharusnyadiukur.Contohsiswadiharapkan

dapatmempraktekkancaramencangkokyang

baik dan benar. Maka penilaian yang guru

lakukan adalah unjuk kerja siswa. Dengan

memberi tugas kepada siswa untuk mem-

praktekkan cara mencangkok; c) Adil,

penilaianyanggurulakukanharusadiluntuk

seluruhsiswa;d)Objektif,dalammenilaihasil

belajar siswa guru harus dapat mejaga

belajar oleh pendidik dilakukan secara

berkesinambunganuntukmemantauproses,

kemajuandanperbaikanhasildalambentuk

ulangan harian, ulangan tengah semester,

ulanganakhirsemesterdanulangankenaikan

kelas.

Darihasilpengamatanyangdiperoleh

kitamasihmenjumpaiguru-gurudiSDNegeri

001 Moro hanya menggunakan tes sebagai

satu-satunya alat ukur keberhasilan belajar

siswa, penggunaan alat ukur masih belum

tepat digunakan. Sebagai contoh tujuan

pembelajaranyangmengandungranahefektif

dan psikomotor tetapi pengukuran hasil

belajarnya hanya dilakukan dengan me-

nggunakantessaja.

Gurumasihberanggapanbahwahasil

tes merupakan satu-satunya indikator

keberhasilan siswa. Ujian akhir sekolah

menjadi satu-satunya tumpuan utama

penilaianhasilbelajarsiswa.Masihrendahnya

tingkat pemahaman guru tentang prinsip-

prinsip penilaian dan penerapannya di SD

Negeri 001 Moro mempengaruhi terhadap

penilaianhasilbelajarbagipesertadidiknya.

Berdasarkan latar belakang diatas

dapatdirumuskanmasalahsebagaiberikut:1)

Bagaimanakah meningkatkan kemampuan

guru dalam dalam melaksanakan penilaian

hasil belajardi SDNegeri001Moromelalui

penerapan prinsip-prinsip penilaian; 2)

Apakah denganmenerapkan prinsip-prinsip

penilaiandiSekolahDasarNegeri001Moro

Kecamatan Moro dapat meningkatkan

kemampuan guru dalam melaksanakan

penilaianhasilbelajarsiswa.

Sesuai dengan rumusan masalah

penelitian, tujuan penelitian ini adalah

sebagai berikut: Untuk meningkatkan

kemampuan profesional guru dalam bidang

menilai hasil belajar siswa SD 001 Moro.

Manfaat Hasil Penelitian: 1) Bagi siswa SD

Negeri 001 Moro sebagai berikut: a)

Meningkatkanmotivasisiswa.Guru harus

menyampaikan kepada siswa mengenai

perencanaan tes yang dibuat oleh guru.

Dengan cara tersebut maka siswa sudah

mengetahui apa yang harus dikerjakannya

dan persyaratan apa yang harus mereka

penuhikalaumerekamenginginkannilaiyang

baik. Dengan cara demikian maka motivasi

anakakan tinggi;b)Siswadapatmelakukan

unjuk kerja dalam situasi nyata dalam

kehidupan sehari-hari; c) Memberi ke-

sempatan kepada siswa untuk melakukan

evaluasidiriterhadaphasilkaryanya;d)Siswa

dapat menggunakan hasil belajar yang

diperoleh disekolah untuk membantu

memecahkan permasalahan yang dihadapi

dalam kehidupan sehari-hari; 2) Bagi Guru-

Guru SD Negeri 001 Moro: a) Memperoleh

pengalaman baru; b) Memiliki wawasan

tentang prinsip-prinsip penilaian; c) Dapat

menerapkan berbagai teknik dan alat

penilaiand)Dapatmenilaihasilbelajaryang

kompleks; e) Dapat menyajikan hasil

penilaian yang tepat, langsung dan lengkap.

Disamping itu penilaian hasil belajar oleh

guru dapat dilakukan terhadap program,

proses dan hasil belajar: 1) Untuk menilai

efektivitas program yang dilaksanakan; 2)

Untuk mengetahui aktivitas dan partisipasi

pesertadidikdalampembelajaran;3)Untuk

mengetahui hasil belajar atau pembentukan

kompetensipesertadidik.

KAJIANTEORI

Penilaian Hasil Belajar Oleh

Pendidik

Penilaian adalah proses sistematis

meliputi pengumpulan informasi (angka,

deskripsi verbal) analisis interprestasi

Page 103: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

102 103

informasi untuk membuat keputusan.

Penilaian merupakan serangkaian kegiatan

untuk memperoleh, menganalisis dan

menafsirkan data tentang proses dan hasil

belajar peserta didik yang dilakukan secara

sistematisdanberkesinambungan sehingga

menjadi informasi yang bermakna dalam

pengambilankeputusan.

Hasil belajar merupakan prestasi

belajarpesertadidiksecarakeseluruhan,yang

menjadi indikator kompetensi dasar dan

derajat perubahan perilaku yang ber-

sangkutan.Penilaianhasilbelajarmerupakan

suatu kegiatan untuk mengukur perubahan

perilakuyang telah terjadipadadiripeserta

didik. Pada umumnya hasil belajar akan

memberikanpengaruhdalamduabentuk:1)

Peserta didik akan mempunyai prespektif

terhadap kekuatan dan kelemahan atas

perilaku yang diinginkan; 2) Mereka men-

dapatkanbahwaperilakuyangdiinginkanitu

telah meningkat setahap atau dua tahap,

sehingga timbul lagi kesenjangan antara

penampilan perilaku sekarang dengan

perilakuyangdiinginkan.

Penilaian hasil belajar oleh pendidik

dapat dilakukan terhadap program, proses

danhasilbelajar.Penilaianprogrambertujuan

untuk menilai efektivitas program yang

dilaksanakan. Penilaian proses bertujuan

untuk mengetahui aktivitas dan partisipasi

pesertadidikdalampembelajaran.Penilaian

hasil bertujuan untuk mengetahui hasil

belajar atau pembentukan kompetensi

pesertadidik.

Seluruh penilaian ini dilakukan oleh

guru untukmengetahui kemajuan dan hasil

belajar peserta didik,mendiagnosa kegiatan

belajar, memberikan umpan balik untuk

memperbaiki proses pembelajaran, dan

menentukan kenaikan kelas bagi setiap

pesertadidik.

Sehubungan dengan penilaian

pembelajaran, Moekijat (1992:69) menge-

mukakanteknikpenilaianpembelajaran,yang

mencakupaspekpengetahuan,keterampilan

dansikapsebagaiberikut:1)Penilaianbelajar

pengetahuan dapat dilakukan dengan ujian

tulis, lisan dan daftar isian pertanyaan; 2)

Penilaian belajar keterampilan, dapat

dilakukan dengan ujian praktek, analisis

keterampilan dan analisis tugas. Serta

penilaian oleh peserta didik sendiri; 3)

Penilaian belajar sikap, dapat dilakukan

dengan daftar isian, sikap dari diri sendiri,

daftar isian sikap yang disesuaikan dengan

tujuan program dan Sekala Deferensial

Sematik(SDS).

Prinsip-prinsipPenilaian

Agar penilaian yang guru lakukan

benar-benardapatmemberigambaranyang

sebenarnyatentangpencapaianhasilbelajar

siswamakadalammelakukanpenilaianguru

perlu memperhatikan prinsip-prinsip

penilaian, Adi Suryanto, dkk (2012) me-

ngemukakana)Berorientasipadapencapaian

kompetensi penilaian yang guru lakukan

harus berfungsi untuk mengukur ke-

tercapaian siswa dalam pencapaian kom-

petensi yang telah ditetapkan dalam

kurikulum; b) Valid, penilaian yang guru

lakukan harus dapat mengukur apa yang

seharusnyadiukur.Contohsiswadiharapkan

dapatmempraktekkancaramencangkokyang

baik dan benar. Maka penilaian yang guru

lakukan adalah unjuk kerja siswa. Dengan

memberi tugas kepada siswa untuk mem-

praktekkan cara mencangkok; c) Adil,

penilaianyanggurulakukanharusadiluntuk

seluruhsiswa;d)Objektif,dalammenilaihasil

belajar siswa guru harus dapat mejaga

belajar oleh pendidik dilakukan secara

berkesinambunganuntukmemantauproses,

kemajuandanperbaikanhasildalambentuk

ulangan harian, ulangan tengah semester,

ulanganakhirsemesterdanulangankenaikan

kelas.

Darihasilpengamatanyangdiperoleh

kitamasihmenjumpaiguru-gurudiSDNegeri

001 Moro hanya menggunakan tes sebagai

satu-satunya alat ukur keberhasilan belajar

siswa, penggunaan alat ukur masih belum

tepat digunakan. Sebagai contoh tujuan

pembelajaranyangmengandungranahefektif

dan psikomotor tetapi pengukuran hasil

belajarnya hanya dilakukan dengan me-

nggunakantessaja.

Gurumasihberanggapanbahwahasil

tes merupakan satu-satunya indikator

keberhasilan siswa. Ujian akhir sekolah

menjadi satu-satunya tumpuan utama

penilaianhasilbelajarsiswa.Masihrendahnya

tingkat pemahaman guru tentang prinsip-

prinsip penilaian dan penerapannya di SD

Negeri 001 Moro mempengaruhi terhadap

penilaianhasilbelajarbagipesertadidiknya.

Berdasarkan latar belakang diatas

dapatdirumuskanmasalahsebagaiberikut:1)

Bagaimanakah meningkatkan kemampuan

guru dalam dalam melaksanakan penilaian

hasil belajardi SDNegeri001Moromelalui

penerapan prinsip-prinsip penilaian; 2)

Apakah denganmenerapkan prinsip-prinsip

penilaiandiSekolahDasarNegeri001Moro

Kecamatan Moro dapat meningkatkan

kemampuan guru dalam melaksanakan

penilaianhasilbelajarsiswa.

Sesuai dengan rumusan masalah

penelitian, tujuan penelitian ini adalah

sebagai berikut: Untuk meningkatkan

kemampuan profesional guru dalam bidang

menilai hasil belajar siswa SD 001 Moro.

Manfaat Hasil Penelitian: 1) Bagi siswa SD

Negeri 001 Moro sebagai berikut: a)

Meningkatkanmotivasisiswa.Guru harus

menyampaikan kepada siswa mengenai

perencanaan tes yang dibuat oleh guru.

Dengan cara tersebut maka siswa sudah

mengetahui apa yang harus dikerjakannya

dan persyaratan apa yang harus mereka

penuhikalaumerekamenginginkannilaiyang

baik. Dengan cara demikian maka motivasi

anakakan tinggi;b)Siswadapatmelakukan

unjuk kerja dalam situasi nyata dalam

kehidupan sehari-hari; c) Memberi ke-

sempatan kepada siswa untuk melakukan

evaluasidiriterhadaphasilkaryanya;d)Siswa

dapat menggunakan hasil belajar yang

diperoleh disekolah untuk membantu

memecahkan permasalahan yang dihadapi

dalam kehidupan sehari-hari; 2) Bagi Guru-

Guru SD Negeri 001 Moro: a) Memperoleh

pengalaman baru; b) Memiliki wawasan

tentang prinsip-prinsip penilaian; c) Dapat

menerapkan berbagai teknik dan alat

penilaiand)Dapatmenilaihasilbelajaryang

kompleks; e) Dapat menyajikan hasil

penilaian yang tepat, langsung dan lengkap.

Disamping itu penilaian hasil belajar oleh

guru dapat dilakukan terhadap program,

proses dan hasil belajar: 1) Untuk menilai

efektivitas program yang dilaksanakan; 2)

Untuk mengetahui aktivitas dan partisipasi

pesertadidikdalampembelajaran;3)Untuk

mengetahui hasil belajar atau pembentukan

kompetensipesertadidik.

KAJIANTEORI

Penilaian Hasil Belajar Oleh

Pendidik

Penilaian adalah proses sistematis

meliputi pengumpulan informasi (angka,

deskripsi verbal) analisis interprestasi

Page 104: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

104 105

Model pelaksanaan tindakan menggunakan

model PTS “Pengawas Satuan Pendidikan

SebagaiPeneliti”,denganacuanmodelsiklus

PTS.Model ini terdiridarisiklus-siklusyang

saling berhubungan. Tiap-tiap siklus terdiri

dari tahapan-tahapan (1) Perencanaan (2)

Tindakan dan Pengamatan (3) Re�leksi, dan

(4)PerbaikanRencana(KemmisdanTuggart:

1990). Dalam penelitian ini, kegiatan dalam

siklus penelitian tindakan sekolah dapat

dipaparkan sebagai berikut: Siklus I terdiri

dari perencanaan, pelaksanaan tindakan,

observasi,re�leksidanperbaikanrencana.

Perencanan,padatahapperencanaan,

pengawas melakukan studi dokumen RPP/

pendahuluaan dengan melakukan re�leksi

terhadapdokumenpenilaianpadaRPPguru

pengawas melakukan wawancara/tanya

jawab dengan guru untuk mengungkapkan

kesulitan-kesulitan yang dialami dan

dirasakanguruketikasedanagmelaksanakan

penilaian pada waktu pembelajaran. Studi

dokumen menghasilkan masalah bahwa

penilaian yang ada pada rencana pem-

belajaran bukan dibuat oleh guru sendiri

tetapimengcopydaridokumenpenilaianyang

sudahadadalamdiktatsilabus.Berdasarkan

masalahdiatas,makapadatahapperencanaan

ini peneliti melakukan kegiatan sebagai

berikut: a) Menyusun instrumen penilaian

yangberkaitandenganpenilaianhasilbelajar

yang penekanannya pada materi prinsip-

prinsippenilaian;b)Menyiapkanruangkelas

sebagai tempat pelaksanaan tes tertulis uji

kompetensi guru tentang penilaian hasil

belajarsiswa.

PelaksanaanTindakandanObservasi,

pada tahap ini, peneliti menyiapkan ins-

trumentuntukdibagi-bagikankepadaguruSD

Negeri001Morodilanjutkandengankegiatan

pelaksanaan tes sesuai dengan waktu yang

telah ditentukan. Penelitimengolahnilai tes

dan mengumpulkan data sebagai bahan

penelitian. Tahap berikutnya penulis

melakukanpengamatan/observasikunjungan

kelas untuk melihat secara langsung

bagaimanaguru-gurudiSDNegeri001Moro

melaksanakanpenilaiandalampembelajaran.

Peneliti merekam berbagai peristiwa

pembelajaran sesuai dengan fokus masalah,

yaitu membuat catatan hasil pengamatan

terhadap proses penilaian dan hasil pem-

belajaran. Mendokumentasikan berbagai

peristiwayangmenjadifokuspenelitian.

Re�leksi, berdasarkan hasil pe-

ngamatan diatas, penelit i kemudian

melakukan re�leksi atas data hasil penilaian

tes kompetensi guru dan catatan hasil

pengamatan/observasi guru yang me-

laksanakan penilaian kepada peserta didik

dalamprosespembelajaran.

SiklusII,SepertipadasiklusI,siklusII

juga mencakup kegiatan perencanaan,

pelaksanaantindakandanobservasi,re�leksi

danperbaikanrencana.Kegiatanpadasetiap

tahapansiklusIIiniakandisesuaikandengan

masalah-masalahyangberhubungandengan

penilaianpadasiklusI.KegiatanpadasiklusI

ditindak lanjuti dan diatasi pada siklus II

dengan melakukan kegiatan bimbingan

melaluiKelompokKerjaGuru (KKG)dengan

materibimbinganpenilaianhasilbelajaroleh

pendidik. Kemudian dilanjutkan dengan

kegiatan penyebaran angket untuk mencari

informasiakanperubahansikapgurusetelah

diberi bimbinganuntukperbaikanpenilaian

hasil belajar padawaktu sekarangdan akan

datang.

InstrumenPenelitian

Instrumenpenelitianyangdigunakan

untuk mengumpul data adalah pedoman

objekti�itas proses dan hasil penilaian; e)

berkesinambungan, penilaian yang guru

lakukan harus terencana, bertahap, teratur,

terus-menerusdanberkesinambunganuntuk

memperoleh informasi hasil belajar dan

perkembanganbelajarsiswa; f)Menyeluruh,

penilaian yang guru lakukan harus mampu

menilai keseluruhan kompetensi yang ter-

dapat dalam kurikulum yang mungkin

meliputi ranah kognitif, afektif dan psi-

komotor;g)Terbuka,kreteriapenilaianharus

terbuka bagi berbagai kalangan sehingga

keputusanhasilbelajarsiswajelasbagipihak-

pihak yang berkepentingan; h) Bermakna,

hasilpenilaianhendaknyadapatmemberikan

gambaranmengenaitingkatpencapaianhasil

belajar siswa, keunggulan dan kelemahan

siswa, minat serta potensi siswa dalam

mencapaikompetensiyangtelahditetapkan.

Standar Penilaian Pendidikan

Penentuan kualitas suatu lembaga

pendidikan, sangatlah ditentukan oleh

penilaian, penilaian-penilaian itu dilakukan

untuk menilai proses pembelajaran, menilai

prestasi siswa dalam suatu bidang pem-

belajaran, menilai kemajuan lembaga itu

sendiri, Martinis Yamin (2006). Dalam

hubungannya dengan tes perbuatan,

Leighbody (1996) mengemukakan elemen-

elemenketerampilan yangdapatdiukur : 1)

Kualitas penyelesaian pekerjaan; 2) Ke-

trampilan menggunakan alat-alat; 3) Ke-

mampuan menganalisis dan merencanakan

prosedurkerjasampaiselesai.4)Kemampuan

mengambil keputusan berdasarkan aplikasi

informasi yang diberikan; 5) Kemampuan

membaca, menggunakan diagram, gambar-

gambar dan simbol-simbol . Sedikitnya

terdapat tujuh hal yang harus diperhatikan

dalam melaksanakan penilaian portopolio

(Mulyasa,2004):a)Karyayangdikumpulkan

benar-benar karya yang bersangkutan; b)

Menentukan contoh pekerjaan yang harus

dikerjakan; c) Mengumpulkan dan me-

nyimpan sampel karya; d) Menentukan

penilaian portopolio; e) Meminta peserta

didik untuk menilai secara terus menerus

hasil portopolionya; f ) Merencanakan

pertemuandenganpesertadidikyangdinilai;

g) Melibatkan orang tua dan masyarakat

dalammenilaiportopolio.

METODOLOGIPENELITIAN

Lokasi dan Waktu Penelitian

Penelitiandilaksanakandi SDNegeri

001 Moro. Pembuatan rencana tindakan

berdasarkan re�leksi yang ditulis pada

proposaldilaksanakanpadabulanNovember

2014sampaidenganApril2015

SubjekPenelitian

Subjek penelitian adalah guru PNS,

Guru GTT dengan jumlah 14 orang. Nama-

nama guru disajikan dalam lampiran. Guru

yang terlibat pada penelitian ini adalah : 1)

Isbiah,S.Pd.SD,2) Mulizarti, S.Pd.SD, 3)

Yunis, S.Pd, 4) Jumiatun, S.Pd.SD, 5) Juliah,

S.Pd, 6) Ramlan, 7) Asmarini, S.Pd.I, 8) Nur

Asiah Siregar, 9) Wahyudi Poriansyah, 11)

Bibimali, 12) Susi Andriani, S.Pd.SD, 13)

Oktaviani,S.Pd.SD;14)Farlino;15)Azmi.

ProsedurPenelitian

Penelitian ini menggunakan ran-

cangan Penelitian Tindakan Sekolah (PTS).

Penelitiantindakansekolahadalahpenelitian

yang bertujuan untuk meningkatkan ke-

mampuan professional guru dan hasil

kegiatan disekolah untuk memecahkan

masalah yang ada didalam latar belakang

penelitian yang dilakukan secara bersiklus.

Page 105: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

104 105

Model pelaksanaan tindakan menggunakan

model PTS “Pengawas Satuan Pendidikan

SebagaiPeneliti”,denganacuanmodelsiklus

PTS.Model ini terdiridarisiklus-siklusyang

saling berhubungan. Tiap-tiap siklus terdiri

dari tahapan-tahapan (1) Perencanaan (2)

Tindakan dan Pengamatan (3) Re�leksi, dan

(4)PerbaikanRencana(KemmisdanTuggart:

1990). Dalam penelitian ini, kegiatan dalam

siklus penelitian tindakan sekolah dapat

dipaparkan sebagai berikut: Siklus I terdiri

dari perencanaan, pelaksanaan tindakan,

observasi,re�leksidanperbaikanrencana.

Perencanan,padatahapperencanaan,

pengawas melakukan studi dokumen RPP/

pendahuluaan dengan melakukan re�leksi

terhadapdokumenpenilaianpadaRPPguru

pengawas melakukan wawancara/tanya

jawab dengan guru untuk mengungkapkan

kesulitan-kesulitan yang dialami dan

dirasakanguruketikasedanagmelaksanakan

penilaian pada waktu pembelajaran. Studi

dokumen menghasilkan masalah bahwa

penilaian yang ada pada rencana pem-

belajaran bukan dibuat oleh guru sendiri

tetapimengcopydaridokumenpenilaianyang

sudahadadalamdiktatsilabus.Berdasarkan

masalahdiatas,makapadatahapperencanaan

ini peneliti melakukan kegiatan sebagai

berikut: a) Menyusun instrumen penilaian

yangberkaitandenganpenilaianhasilbelajar

yang penekanannya pada materi prinsip-

prinsippenilaian;b)Menyiapkanruangkelas

sebagai tempat pelaksanaan tes tertulis uji

kompetensi guru tentang penilaian hasil

belajarsiswa.

PelaksanaanTindakandanObservasi,

pada tahap ini, peneliti menyiapkan ins-

trumentuntukdibagi-bagikankepadaguruSD

Negeri001Morodilanjutkandengankegiatan

pelaksanaan tes sesuai dengan waktu yang

telah ditentukan. Penelitimengolahnilai tes

dan mengumpulkan data sebagai bahan

penelitian. Tahap berikutnya penulis

melakukanpengamatan/observasikunjungan

kelas untuk melihat secara langsung

bagaimanaguru-gurudiSDNegeri001Moro

melaksanakanpenilaiandalampembelajaran.

Peneliti merekam berbagai peristiwa

pembelajaran sesuai dengan fokus masalah,

yaitu membuat catatan hasil pengamatan

terhadap proses penilaian dan hasil pem-

belajaran. Mendokumentasikan berbagai

peristiwayangmenjadifokuspenelitian.

Re�leksi, berdasarkan hasil pe-

ngamatan diatas, penelit i kemudian

melakukan re�leksi atas data hasil penilaian

tes kompetensi guru dan catatan hasil

pengamatan/observasi guru yang me-

laksanakan penilaian kepada peserta didik

dalamprosespembelajaran.

SiklusII,SepertipadasiklusI,siklusII

juga mencakup kegiatan perencanaan,

pelaksanaantindakandanobservasi,re�leksi

danperbaikanrencana.Kegiatanpadasetiap

tahapansiklusIIiniakandisesuaikandengan

masalah-masalahyangberhubungandengan

penilaianpadasiklusI.KegiatanpadasiklusI

ditindak lanjuti dan diatasi pada siklus II

dengan melakukan kegiatan bimbingan

melaluiKelompokKerjaGuru (KKG)dengan

materibimbinganpenilaianhasilbelajaroleh

pendidik. Kemudian dilanjutkan dengan

kegiatan penyebaran angket untuk mencari

informasiakanperubahansikapgurusetelah

diberi bimbinganuntukperbaikanpenilaian

hasil belajar padawaktu sekarangdan akan

datang.

InstrumenPenelitian

Instrumenpenelitianyangdigunakan

untuk mengumpul data adalah pedoman

objekti�itas proses dan hasil penilaian; e)

berkesinambungan, penilaian yang guru

lakukan harus terencana, bertahap, teratur,

terus-menerusdanberkesinambunganuntuk

memperoleh informasi hasil belajar dan

perkembanganbelajarsiswa; f)Menyeluruh,

penilaian yang guru lakukan harus mampu

menilai keseluruhan kompetensi yang ter-

dapat dalam kurikulum yang mungkin

meliputi ranah kognitif, afektif dan psi-

komotor;g)Terbuka,kreteriapenilaianharus

terbuka bagi berbagai kalangan sehingga

keputusanhasilbelajarsiswajelasbagipihak-

pihak yang berkepentingan; h) Bermakna,

hasilpenilaianhendaknyadapatmemberikan

gambaranmengenaitingkatpencapaianhasil

belajar siswa, keunggulan dan kelemahan

siswa, minat serta potensi siswa dalam

mencapaikompetensiyangtelahditetapkan.

Standar Penilaian Pendidikan

Penentuan kualitas suatu lembaga

pendidikan, sangatlah ditentukan oleh

penilaian, penilaian-penilaian itu dilakukan

untuk menilai proses pembelajaran, menilai

prestasi siswa dalam suatu bidang pem-

belajaran, menilai kemajuan lembaga itu

sendiri, Martinis Yamin (2006). Dalam

hubungannya dengan tes perbuatan,

Leighbody (1996) mengemukakan elemen-

elemenketerampilan yangdapatdiukur : 1)

Kualitas penyelesaian pekerjaan; 2) Ke-

trampilan menggunakan alat-alat; 3) Ke-

mampuan menganalisis dan merencanakan

prosedurkerjasampaiselesai.4)Kemampuan

mengambil keputusan berdasarkan aplikasi

informasi yang diberikan; 5) Kemampuan

membaca, menggunakan diagram, gambar-

gambar dan simbol-simbol . Sedikitnya

terdapat tujuh hal yang harus diperhatikan

dalam melaksanakan penilaian portopolio

(Mulyasa,2004):a)Karyayangdikumpulkan

benar-benar karya yang bersangkutan; b)

Menentukan contoh pekerjaan yang harus

dikerjakan; c) Mengumpulkan dan me-

nyimpan sampel karya; d) Menentukan

penilaian portopolio; e) Meminta peserta

didik untuk menilai secara terus menerus

hasil portopolionya; f ) Merencanakan

pertemuandenganpesertadidikyangdinilai;

g) Melibatkan orang tua dan masyarakat

dalammenilaiportopolio.

METODOLOGIPENELITIAN

Lokasi dan Waktu Penelitian

Penelitiandilaksanakandi SDNegeri

001 Moro. Pembuatan rencana tindakan

berdasarkan re�leksi yang ditulis pada

proposaldilaksanakanpadabulanNovember

2014sampaidenganApril2015

SubjekPenelitian

Subjek penelitian adalah guru PNS,

Guru GTT dengan jumlah 14 orang. Nama-

nama guru disajikan dalam lampiran. Guru

yang terlibat pada penelitian ini adalah : 1)

Isbiah,S.Pd.SD,2) Mulizarti, S.Pd.SD, 3)

Yunis, S.Pd, 4) Jumiatun, S.Pd.SD, 5) Juliah,

S.Pd, 6) Ramlan, 7) Asmarini, S.Pd.I, 8) Nur

Asiah Siregar, 9) Wahyudi Poriansyah, 11)

Bibimali, 12) Susi Andriani, S.Pd.SD, 13)

Oktaviani,S.Pd.SD;14)Farlino;15)Azmi.

ProsedurPenelitian

Penelitian ini menggunakan ran-

cangan Penelitian Tindakan Sekolah (PTS).

Penelitiantindakansekolahadalahpenelitian

yang bertujuan untuk meningkatkan ke-

mampuan professional guru dan hasil

kegiatan disekolah untuk memecahkan

masalah yang ada didalam latar belakang

penelitian yang dilakukan secara bersiklus.

Page 106: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

106 107

Tabel2.Hasil Siklus IiPenilaianUjiKemampuanGuruSDNegeri001MorodalamMemahamiPrinsip-PrinsipPenilaian

No NamaGuruPangkat

Gol/RuangMasaKerja

TugasMengajar

ButirSoal SkorPerolehan

Persentase

Ket1 2 3 4 5

1 A1 PembinaIV/a

GuruKelasIV.a

B

C

C

A

C

80 80%2 A2 PembinaIV/a

GuruKelasI.a

B

C

C

D

B

80 80%3 A3 PembinaIV/a

GuruKelasVI.b

B

C

C

A

B

100 100%4 A4 PembinaIV/a

GuruKelasVI.a

B

C

C

A

B

100 100%5 A5 PembinaIII/d

GuruKelasI.b

B

C

C

A

A

80 80%

6 A6

GuruKelasV.a

B

C

C

A

B

100 100%7 A7 PengaturII.c GuruPAI B C A A C 60 60%8 A8 II.c GuruKelasIV.b B C C A B 100 100%9 A9 Peng.MudaII.a

GuruKelasIII.b

A

B

D

A

A

10 10%

10 A10 Peng.MudaII.a

GuruKelasV.b

B

C

C

C

B

80 80%

11 A11 Peng.MudaII.a

GuruKelasIII.a

B

C

B

D

B

60 60%12 A12 -

GuruKelasIII.c

B

C

B

B

B

40 40%13 A13 -

GuruPenjas

B

C

C

D

B

60 60%14 A14 - GuruKebda B C C D D 40 40%

Rata-Rata100% 85% 77% 62% 69%0% 15% 23% 38% 21%

Kesimpulandarihasilangketdidapatdata:1)

TeknikpenilaiandalamRPP100%dibuatoleh

guru masing-masing (pribadi); 2) Dalam

memilih aspek Kognitif (pengetahuan) guru

yangsudahmemahami85% danguruyang

belum menguasi 15%; 3) Dalam memilih

aspek psikomotor (keterampilan) 77% guru

menggunakan instrument unjuk kerja dan

23% guru yang belummenggunakannya; 4)

Pemahaman guru tentang teknik non tes

(angket) 62%; 5) Pemahaman guru tentang

prinsip berkesinambungan dalam penilaian

hasilbelajarhanya69%.

Re�leksi,Padare�leksikeduadarihasil

proses pelaksanaan penilaian / observasi

melaluipenerapanprinsip-prinsippenilaian.

Pembahasan

Perencanantindakandisusunsebagai

berikut: (1)Menyusun rencana pengamatan

studi dokumen penilaian dalam program

semester, silabusdanRPPyangdibuatguru,

(2) Membuat format observasi dan format

penilaian, (3) Menyusun tes uji kompetensi

guru.

Pengamatan dilakukan diruang ma-

jelis guru SD Negeri 001 Moro dengan

memeriksa dan mengamati kesesuaian

anatara teknik penilaian yang ada dalam

program semester, silabus dan RPP yang

dibuatolehguru. Mengadakan tanya jawab

tentang apa yang diamati/dilihat dalam

dokumen-dokumen yang dibuat oleh guru.

Data penelitian hasil pengamatan/observasi

dokumen guru yang berkaitan dengan

penilaian yang diisi dalam format observasi

danformatpenilaian.

Re�leksi, pada bagian re�leksi ini

ditemukan beberapa hal tentang proses

observasi/pengamatan study dokumen

penilaiangurusebagaiberikut:1)Darihasil

penelitian menunjukkan bahwa guru pada

umumnya sudah menggunakan berbagai

teknik dan instrument penilaian namun

bukan hasil karya sendiri tetapi mengcopy

daridokumenyangdibuatoranglain;2)Dari

hasil tanya jawab antara peneliti dan guru

dapat dibuat suatu perkiraan bahwa teknik

daninstrumentpenilaianyangdibuatkadang-

kadangtidakdimengertiolehguruitusendiri;

3)Dari hasil tes uji kompetensi gurudalam

bidang hasil penilaian hasil belajar yang

dilaksanakanmasibelummencapaihasilyang

maksimal sehingga perlu diberikan

bimbinganpadasiklusberikutnya(SiklusII).

Perencanaan,kegiatanyangdilakukan

wawancara, instrumentes, lembarobservasi

danangket.

PengumpulanData

Teknik pengumpulan data yang

digunakan dalam penelitian ini adalah

observasi dan dokumentasi. 1) Teknik

Observasi, digunakan untuk mengamati

segala gejala yang tampak dalam proses

penilaiantentangsemuacarayangdigunakan

guru dalam penilaian hasil belajar diruang

kelas dimana guru melaksanakan pem-

belajaran;2)TeknikDokumentasi,digunakan

untuk mendokumentasikan data tentang

prosespenilaianhasilbelajarolehgurumulai

dari teknik dan instrument penilaian yang

digunakan oleh guru dalam rencana

pembelajaran, instrument hasil pengamatan

diruang kelas, soal tes uji kompetensi guru

dalammenguasaimateripenilaian,dokumen

keikutsertaangurudalamkegiatanbimbingan

KKG.

HASIL PENELITIAN DAN

PEMBAHASAAN

Hasil Penelitian

Deskripsi aktivitas: Meningkatkan

Kemampuan Guru dalam Penilaian Hasil

Belajar Siswa Melalui Penerapan Prinsip-

PrinsipPenilaiandiSDNegeri001Moro.

SiklusI

Hasilpenelitianmenunjukkanbahwa

gurupadaumumnyasudahmenyusunteknik

dan instrument penilaian namun semua itu

masihmengcopydaridokumendiktat/buku

yangdibuatolehoranglain.

Tabel 1. Hasil siklus IpenilaianujikemampuanguruSDNegeri001Morodalammemahamiprinsip-prinsippenilaian

NoNamaGuru

Gol/Ruang

TugasMengajarButirSoal Skor

Perolehan

Persentase

Ket1 2 3 4 5 6 7 8 9 10

1 A1 IV/a GuruKelasIV.a

0

0

0

0

1

1

1

1

1

0

5 50%2 A2 IV/a GuruKelasI.a

0

0

0

0

0

1

0

0

1

0

2 20%

3 A3 IV/a GuruKelasVI.b

1

1

0

0

1

1

0

1

1

0

6 60%4 A4 IV/a GuruKelasVI.a

1

0

0

0

0

0

1

1

0

1

4 40%5 A5 III/d GuruKelasI.b

1

1

0

1

0

1

1

0

1

0

6 60%

6 A6 III/a GuruKelasV.a

1

0

0

1

1

0

1

1

1

1

7 70%7 A7 II.c GuruPAI 1 1 0 1 0 1 1 1 1 0 7 70%8 A8 II.c GuruKelasIV.b 0 0 1 0 1 1 0 1 0 1 5 50%9 A9 II.a GuruKelasIII.b

0

0

0

0

1

0

1

0

1

0

3 30%

10 A10 II.a GuruKelasV.b

0

0

0

0

0

0

1

1

1

1

4 40%

11 A11 II.a GuruKelasIII.a

1

0

0

0

1

1

0

1

0

0

4 40%12 A12 - GuruKelasIII.c

1

1

0

0

1

1

1

0

0

0

5 50%13 A13 - GuruPenjas 1 0 0 0 0 0 0 0 0 0 1 10%14 A14 - GuruKebda 0 0 0 0 1 0 1 0 0 0 2 20%

Rata-Rata8 5 0 3 8 8 9 8 8 4

4,35 43,5%57% 36% 0% 21% 57% 57% 64% 57% 57% 25%

Beberapahalyangdirencanakanpadasiklus

II: 1) Memberikan bimbingan kepada guru-

guru untuk selalu melaksanakan penilaian

sesuai dengan prinsip-prinsip penilaian; 2)

Mengembangkan berbagai teknik dan ins-

trumenpenilaiandalamprosespembelajaran.

SiklusII

Hasilpenelitianmenunjukkanbahwa

guru sudah banyak memahami, mengalami

perkembangan dan perubahan sikap dalam

melaksanakanhasilbelajar

Page 107: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

106 107

Tabel2.Hasil Siklus IiPenilaianUjiKemampuanGuruSDNegeri001MorodalamMemahamiPrinsip-PrinsipPenilaian

No NamaGuruPangkat

Gol/RuangMasaKerja

TugasMengajar

ButirSoal SkorPerolehan

Persentase

Ket1 2 3 4 5

1 A1 PembinaIV/a

GuruKelasIV.a

B

C

C

A

C

80 80%2 A2 PembinaIV/a

GuruKelasI.a

B

C

C

D

B

80 80%3 A3 PembinaIV/a

GuruKelasVI.b

B

C

C

A

B

100 100%4 A4 PembinaIV/a

GuruKelasVI.a

B

C

C

A

B

100 100%5 A5 PembinaIII/d

GuruKelasI.b

B

C

C

A

A

80 80%

6 A6

GuruKelasV.a

B

C

C

A

B

100 100%7 A7 PengaturII.c GuruPAI B C A A C 60 60%8 A8 II.c GuruKelasIV.b B C C A B 100 100%9 A9 Peng.MudaII.a

GuruKelasIII.b

A

B

D

A

A

10 10%

10 A10 Peng.MudaII.a

GuruKelasV.b

B

C

C

C

B

80 80%

11 A11 Peng.MudaII.a

GuruKelasIII.a

B

C

B

D

B

60 60%12 A12 -

GuruKelasIII.c

B

C

B

B

B

40 40%13 A13 -

GuruPenjas

B

C

C

D

B

60 60%14 A14 - GuruKebda B C C D D 40 40%

Rata-Rata100% 85% 77% 62% 69%0% 15% 23% 38% 21%

Kesimpulandarihasilangketdidapatdata:1)

TeknikpenilaiandalamRPP100%dibuatoleh

guru masing-masing (pribadi); 2) Dalam

memilih aspek Kognitif (pengetahuan) guru

yangsudahmemahami85% danguruyang

belum menguasi 15%; 3) Dalam memilih

aspek psikomotor (keterampilan) 77% guru

menggunakan instrument unjuk kerja dan

23% guru yang belummenggunakannya; 4)

Pemahaman guru tentang teknik non tes

(angket) 62%; 5) Pemahaman guru tentang

prinsip berkesinambungan dalam penilaian

hasilbelajarhanya69%.

Re�leksi,Padare�leksikeduadarihasil

proses pelaksanaan penilaian / observasi

melaluipenerapanprinsip-prinsippenilaian.

Pembahasan

Perencanantindakandisusunsebagai

berikut: (1)Menyusun rencana pengamatan

studi dokumen penilaian dalam program

semester, silabusdanRPPyangdibuatguru,

(2) Membuat format observasi dan format

penilaian, (3) Menyusun tes uji kompetensi

guru.

Pengamatan dilakukan diruang ma-

jelis guru SD Negeri 001 Moro dengan

memeriksa dan mengamati kesesuaian

anatara teknik penilaian yang ada dalam

program semester, silabus dan RPP yang

dibuatolehguru. Mengadakan tanya jawab

tentang apa yang diamati/dilihat dalam

dokumen-dokumen yang dibuat oleh guru.

Data penelitian hasil pengamatan/observasi

dokumen guru yang berkaitan dengan

penilaian yang diisi dalam format observasi

danformatpenilaian.

Re�leksi, pada bagian re�leksi ini

ditemukan beberapa hal tentang proses

observasi/pengamatan study dokumen

penilaiangurusebagaiberikut:1)Darihasil

penelitian menunjukkan bahwa guru pada

umumnya sudah menggunakan berbagai

teknik dan instrument penilaian namun

bukan hasil karya sendiri tetapi mengcopy

daridokumenyangdibuatoranglain;2)Dari

hasil tanya jawab antara peneliti dan guru

dapat dibuat suatu perkiraan bahwa teknik

daninstrumentpenilaianyangdibuatkadang-

kadangtidakdimengertiolehguruitusendiri;

3)Dari hasil tes uji kompetensi gurudalam

bidang hasil penilaian hasil belajar yang

dilaksanakanmasibelummencapaihasilyang

maksimal sehingga perlu diberikan

bimbinganpadasiklusberikutnya(SiklusII).

Perencanaan,kegiatanyangdilakukan

wawancara, instrumentes, lembarobservasi

danangket.

PengumpulanData

Teknik pengumpulan data yang

digunakan dalam penelitian ini adalah

observasi dan dokumentasi. 1) Teknik

Observasi, digunakan untuk mengamati

segala gejala yang tampak dalam proses

penilaiantentangsemuacarayangdigunakan

guru dalam penilaian hasil belajar diruang

kelas dimana guru melaksanakan pem-

belajaran;2)TeknikDokumentasi,digunakan

untuk mendokumentasikan data tentang

prosespenilaianhasilbelajarolehgurumulai

dari teknik dan instrument penilaian yang

digunakan oleh guru dalam rencana

pembelajaran, instrument hasil pengamatan

diruang kelas, soal tes uji kompetensi guru

dalammenguasaimateripenilaian,dokumen

keikutsertaangurudalamkegiatanbimbingan

KKG.

HASIL PENELITIAN DAN

PEMBAHASAAN

Hasil Penelitian

Deskripsi aktivitas: Meningkatkan

Kemampuan Guru dalam Penilaian Hasil

Belajar Siswa Melalui Penerapan Prinsip-

PrinsipPenilaiandiSDNegeri001Moro.

SiklusI

Hasilpenelitianmenunjukkanbahwa

gurupadaumumnyasudahmenyusunteknik

dan instrument penilaian namun semua itu

masihmengcopydaridokumendiktat/buku

yangdibuatolehoranglain.

Tabel 1. Hasil siklus IpenilaianujikemampuanguruSDNegeri001Morodalammemahamiprinsip-prinsippenilaian

NoNamaGuru

Gol/Ruang

TugasMengajarButirSoal Skor

Perolehan

Persentase

Ket1 2 3 4 5 6 7 8 9 10

1 A1 IV/a GuruKelasIV.a

0

0

0

0

1

1

1

1

1

0

5 50%2 A2 IV/a GuruKelasI.a

0

0

0

0

0

1

0

0

1

0

2 20%

3 A3 IV/a GuruKelasVI.b

1

1

0

0

1

1

0

1

1

0

6 60%4 A4 IV/a GuruKelasVI.a

1

0

0

0

0

0

1

1

0

1

4 40%5 A5 III/d GuruKelasI.b

1

1

0

1

0

1

1

0

1

0

6 60%

6 A6 III/a GuruKelasV.a

1

0

0

1

1

0

1

1

1

1

7 70%7 A7 II.c GuruPAI 1 1 0 1 0 1 1 1 1 0 7 70%8 A8 II.c GuruKelasIV.b 0 0 1 0 1 1 0 1 0 1 5 50%9 A9 II.a GuruKelasIII.b

0

0

0

0

1

0

1

0

1

0

3 30%

10 A10 II.a GuruKelasV.b

0

0

0

0

0

0

1

1

1

1

4 40%

11 A11 II.a GuruKelasIII.a

1

0

0

0

1

1

0

1

0

0

4 40%12 A12 - GuruKelasIII.c

1

1

0

0

1

1

1

0

0

0

5 50%13 A13 - GuruPenjas 1 0 0 0 0 0 0 0 0 0 1 10%14 A14 - GuruKebda 0 0 0 0 1 0 1 0 0 0 2 20%

Rata-Rata8 5 0 3 8 8 9 8 8 4

4,35 43,5%57% 36% 0% 21% 57% 57% 64% 57% 57% 25%

Beberapahalyangdirencanakanpadasiklus

II: 1) Memberikan bimbingan kepada guru-

guru untuk selalu melaksanakan penilaian

sesuai dengan prinsip-prinsip penilaian; 2)

Mengembangkan berbagai teknik dan ins-

trumenpenilaiandalamprosespembelajaran.

SiklusII

Hasilpenelitianmenunjukkanbahwa

guru sudah banyak memahami, mengalami

perkembangan dan perubahan sikap dalam

melaksanakanhasilbelajar

Page 108: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

108 109

PENERAPANSTRATEGIPINTARDALAMPENGELOLAANEKSTRAKURIKULERUNTUKMENINGKATKANPRESTASINONAKADEMIK

DISMPNEGERI41BATAM

Wagiyem*

Abstrak:Tujuanpenulisanbestpracticeiniadalahuntukmeningkatkanprestasinon-akademikpesertadidikdiSMPNegeri41Batam.JenispenelitianinideskriptifkualitatifdilaksanakandiSMPNegeri41Batamtahunpelajaran2016/2017.Datadiperolehdengancarapendokumentasianpelaksanaankegiatanekstrakurikulersekolah. Berdasarkan dokumentasi dan praktik penyelenggaraan pelayanan kegiatan ekstrakurikuler disekolah dapat disimpulkan bahwa terjadi peningkatan prestasi non-akademik di SMPNegeri 41 Batamantaralain:1)Senikriyayangdiwujudkandenganlombakewirausahaanmencapaijuaraharapansatuditingkatnasional;2)Senirupayangmeliputisenilukis,desainmotifbatik,danpostersudahmendapatkanjuaraditingkatnasional.JuaraharapantigaditingkatnasionaluntukdesainmotifbatikyangdilaksanakandiIstanaNegaraCipanas,JuaraharapanduatingkatnasionaluntuklombaposteryangdiadakandiPalembang,danuntukseni lukissudahbeberapakalimengikutisampaike tingkatnasionalsebagai �inalis,dan jugasebagaiutusanprovinsiKepulauanRiauketingkatnasionalyangsudahdilaksanakantahun2016;dan3)Karyailmiahsudahpernahsampaiketingkatnasionalsebagai�inalisdalamlombasanitasilingkunganyangdiadakanolehDinasPekerjaanUmum.

KataKunci:Pintar,Ekstrakurikuler,PrestasiNon-akademik.

PENDAHULUAN

Mewujudkan sekolahyang memiliki

kemajuan dalam segala bidang bukan

merupakan hal yang mudah. Namun hal ini

tidakbolehmenyurutkanniatdankeinginan

kita. Segala hal dapat diraih dan dibuktikan

dengantekaddansemangatyangtinggiserta

keinginan yang besar. Hal ini harus benar-

benar didukung, karena tidak ada hal yang

tidak mungkin, apabila kita mau me-

laksanakandanmengusahakannya.

SMP Negeri 41 Batam ingin mem-

berikanmuatanpendidikanbagiparapeserta

didik dengan dimensi intektualitas (in-

telegensia), emosional, dan spiritual. Tiga

dimensi ini dinilai sangat penting dalam

pengembangan diri dan potensi manusia.

Kecerdasan manusia paripurna senantiasa

akanmeliputiketigaaspekyangsalingterkait

dan menentukan optimalisasi kemampuan

manusia itu sendiri (Kartini Batam: 65).

Untukdapatmemperolehpesertadidikyang

memilikiaspektersebutmakapembahasanini

akan difokuskan pada kegiatan eks-

trakurikuler.

Berbagai kegiatan ekstrakurikuler

telahdilaksanakandi SMPNegeri 41Batam

namun untuk memperoleh hasil yang baik

atau memuaskan tentu tidak semudah

membalikkan telapak tangan. Apalagi pada

awalnyapesertadidik jugakurangberminat

terhadap kegiatan-kegiatan ekstrakurikuler

yang dilaksanakan. Selain itu, tidak dapat

dipungkiri bahwa keterbatasan sarana dan

pembina juga menjadi kendala dalam

keberhasilankegiatanekstrakurikulerdiSMP

Negeri41Batam.

Jenis-jenis kegiatan ekstrakurikuler

yang diadakan di SMP Negeri 41 Batam

diantaranyaolahragayangmeliputibolavoli,

takraw, sepak bola, tenis meja dan altetik.

Kegiatan ekstrakurikuler di bidang seni

meliputisenikriya,seni lukis,poster,desain

batik, kompang dan nasyid. Kegiatan

dibidang sastrayangterdiriatas ciptapuisi,

dalam tahap perencanaan pada siklus II ini,

antara lain: 1) Merencanakan kegiatan

bimbingantentangpenerapanprinsip-prinsip

penilaian, teknik penilaian dan penyusunan

instrument penilaian; 2)Menyusun rencana

pelaksanaan tes uji kompetensi guru yang

kedua; 3) Penyebaran angket untuk me-

ngetahui perubahan sikap guru terhadap

penilaianhasilbelajarsiswa;4)Menyiapkan

format data penilaian dan format data

observasi.

PelaksanaanTindakandanObservasi,

Pada siklus II kegiatan yang dilaksanakan

adalah: 1) Melaksanakan bimbingan secara

langsung kepada guru-guru SDN 001 Moro

tentangpenerapanprinsip-prinsippenilaian,

teknikpenilaiandanpenyusunaninstrument

penilaian dalam pembelajaran; 2) Melak-

sanakantesujikompetensiguruyangkedua

untuk menguji pemahaman guru tentang

materiyangtelahdiberikandalambimbingan;

3)Mengolahnilaihasiltesyangkeduauntuk

dijadikandata;4)Menyebarkanangketuntuk

menilai perubahan sikap guru terhadap

penerapan prinsip-prinsip, teknik dan

instrument penilaian hasil belajar sekarang

dan akan datang dalam rangka peningkatan

mutu pendidikan di SDN 001 Moro; 5)

Mengolahdatahasilangketyangsudahberisi.

SIMPULANDANSARAN

Simpulan

Simpulanyangdiperolehberdasarkan

penelitian ini adalah sebagai berikut: 1)

Denganpenerapanprinsip-prinsippenilaian

di SDN 001 Moro, kemampuan guru-guru

dalammelaksanakan penilaian hasil belajar

siswa banyakmengalami perubahan kearah

yanglebihbaikterutamadalampemahaman

tentangprinsip-prinsippenilaian;2)Dengan

memahami berbagai teknik penilaian guru-

guru di SDN 001 Moro sudah dapat

menerapkanberbagaiteknikpenilaiandalam

prosespembelajarandikelasmasing-masing.

Saran

Berdasarkanhasilpenilitianinimaka

dapat diajukan saran sebagai berikut: 1Bagi

Guru,agarpenilaianhasilbelajarsiswadapat

dilaksanakan dengan baik guru diharapkan

memahamidanmampumenerapkanprinsip-

prinsip penilaian di SDN 001Moro; 2) Bagi

Kepala Sekolah SDN 001 Moro. Hasil

penelitianinidapatdigunakansebagaidasar

kebijakan oleh kepala SDN001Morodalam

mengatasi rendahnya penilaian hasil belajar

siswadiSDN001Moro.

DAFTARPUSTAKA

Ahmad,Djauzah,1994.PetunjukPelaksanaanPenilaiandiSekolahDasar.

Mulyasa , E , 2008. Kesimpulan yangdisempurnakan.Bandung : PT. RemajaRosdaKarya.

Nasution, Nochi dan Adi Suryanto. 2008.EvaluasiPenyajian.Jakarta:UniversitasTerbuka.

Suryanto , Adi , dkk . 2012. Evaluas iPembelajaran di SD. TanggerangSelatan:UniversitasTerbuka.

Yamin, Martius, 2006. Serti�ikasi ProfesiKeguruan di Indonesia.Jakarta : CjangPersadaPress.

Zainul,Asnawi&Agus,Mulyana,2003.TesdanAsasmen di SD. Jakarta : UniversitasTerbuka.

Page 109: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

108 109

PENERAPANSTRATEGIPINTARDALAMPENGELOLAANEKSTRAKURIKULERUNTUKMENINGKATKANPRESTASINONAKADEMIK

DISMPNEGERI41BATAM

Wagiyem*

Abstrak:Tujuanpenulisanbestpracticeiniadalahuntukmeningkatkanprestasinon-akademikpesertadidikdiSMPNegeri41Batam.JenispenelitianinideskriptifkualitatifdilaksanakandiSMPNegeri41Batamtahunpelajaran2016/2017.Datadiperolehdengancarapendokumentasianpelaksanaankegiatanekstrakurikulersekolah. Berdasarkan dokumentasi dan praktik penyelenggaraan pelayanan kegiatan ekstrakurikuler disekolah dapat disimpulkan bahwa terjadi peningkatan prestasi non-akademik di SMPNegeri 41 Batamantaralain:1)Senikriyayangdiwujudkandenganlombakewirausahaanmencapaijuaraharapansatuditingkatnasional;2)Senirupayangmeliputisenilukis,desainmotifbatik,danpostersudahmendapatkanjuaraditingkatnasional.JuaraharapantigaditingkatnasionaluntukdesainmotifbatikyangdilaksanakandiIstanaNegaraCipanas,JuaraharapanduatingkatnasionaluntuklombaposteryangdiadakandiPalembang,danuntukseni lukissudahbeberapakalimengikutisampaike tingkatnasionalsebagai �inalis,dan jugasebagaiutusanprovinsiKepulauanRiauketingkatnasionalyangsudahdilaksanakantahun2016;dan3)Karyailmiahsudahpernahsampaiketingkatnasionalsebagai�inalisdalamlombasanitasilingkunganyangdiadakanolehDinasPekerjaanUmum.

KataKunci:Pintar,Ekstrakurikuler,PrestasiNon-akademik.

PENDAHULUAN

Mewujudkan sekolahyang memiliki

kemajuan dalam segala bidang bukan

merupakan hal yang mudah. Namun hal ini

tidakbolehmenyurutkanniatdankeinginan

kita. Segala hal dapat diraih dan dibuktikan

dengantekaddansemangatyangtinggiserta

keinginan yang besar. Hal ini harus benar-

benar didukung, karena tidak ada hal yang

tidak mungkin, apabila kita mau me-

laksanakandanmengusahakannya.

SMP Negeri 41 Batam ingin mem-

berikanmuatanpendidikanbagiparapeserta

didik dengan dimensi intektualitas (in-

telegensia), emosional, dan spiritual. Tiga

dimensi ini dinilai sangat penting dalam

pengembangan diri dan potensi manusia.

Kecerdasan manusia paripurna senantiasa

akanmeliputiketigaaspekyangsalingterkait

dan menentukan optimalisasi kemampuan

manusia itu sendiri (Kartini Batam: 65).

Untukdapatmemperolehpesertadidikyang

memilikiaspektersebutmakapembahasanini

akan difokuskan pada kegiatan eks-

trakurikuler.

Berbagai kegiatan ekstrakurikuler

telahdilaksanakandi SMPNegeri 41Batam

namun untuk memperoleh hasil yang baik

atau memuaskan tentu tidak semudah

membalikkan telapak tangan. Apalagi pada

awalnyapesertadidik jugakurangberminat

terhadap kegiatan-kegiatan ekstrakurikuler

yang dilaksanakan. Selain itu, tidak dapat

dipungkiri bahwa keterbatasan sarana dan

pembina juga menjadi kendala dalam

keberhasilankegiatanekstrakurikulerdiSMP

Negeri41Batam.

Jenis-jenis kegiatan ekstrakurikuler

yang diadakan di SMP Negeri 41 Batam

diantaranyaolahragayangmeliputibolavoli,

takraw, sepak bola, tenis meja dan altetik.

Kegiatan ekstrakurikuler di bidang seni

meliputisenikriya,seni lukis,poster,desain

batik, kompang dan nasyid. Kegiatan

dibidang sastrayangterdiriatas ciptapuisi,

dalam tahap perencanaan pada siklus II ini,

antara lain: 1) Merencanakan kegiatan

bimbingantentangpenerapanprinsip-prinsip

penilaian, teknik penilaian dan penyusunan

instrument penilaian; 2)Menyusun rencana

pelaksanaan tes uji kompetensi guru yang

kedua; 3) Penyebaran angket untuk me-

ngetahui perubahan sikap guru terhadap

penilaianhasilbelajarsiswa;4)Menyiapkan

format data penilaian dan format data

observasi.

PelaksanaanTindakandanObservasi,

Pada siklus II kegiatan yang dilaksanakan

adalah: 1) Melaksanakan bimbingan secara

langsung kepada guru-guru SDN 001 Moro

tentangpenerapanprinsip-prinsippenilaian,

teknikpenilaiandanpenyusunaninstrument

penilaian dalam pembelajaran; 2) Melak-

sanakantesujikompetensiguruyangkedua

untuk menguji pemahaman guru tentang

materiyangtelahdiberikandalambimbingan;

3)Mengolahnilaihasiltesyangkeduauntuk

dijadikandata;4)Menyebarkanangketuntuk

menilai perubahan sikap guru terhadap

penerapan prinsip-prinsip, teknik dan

instrument penilaian hasil belajar sekarang

dan akan datang dalam rangka peningkatan

mutu pendidikan di SDN 001 Moro; 5)

Mengolahdatahasilangketyangsudahberisi.

SIMPULANDANSARAN

Simpulan

Simpulanyangdiperolehberdasarkan

penelitian ini adalah sebagai berikut: 1)

Denganpenerapanprinsip-prinsippenilaian

di SDN 001 Moro, kemampuan guru-guru

dalammelaksanakan penilaian hasil belajar

siswa banyakmengalami perubahan kearah

yanglebihbaikterutamadalampemahaman

tentangprinsip-prinsippenilaian;2)Dengan

memahami berbagai teknik penilaian guru-

guru di SDN 001 Moro sudah dapat

menerapkanberbagaiteknikpenilaiandalam

prosespembelajarandikelasmasing-masing.

Saran

Berdasarkanhasilpenilitianinimaka

dapat diajukan saran sebagai berikut: 1Bagi

Guru,agarpenilaianhasilbelajarsiswadapat

dilaksanakan dengan baik guru diharapkan

memahamidanmampumenerapkanprinsip-

prinsip penilaian di SDN 001Moro; 2) Bagi

Kepala Sekolah SDN 001 Moro. Hasil

penelitianinidapatdigunakansebagaidasar

kebijakan oleh kepala SDN001Morodalam

mengatasi rendahnya penilaian hasil belajar

siswadiSDN001Moro.

DAFTARPUSTAKA

Ahmad,Djauzah,1994.PetunjukPelaksanaanPenilaiandiSekolahDasar.

Mulyasa , E , 2008. Kesimpulan yangdisempurnakan.Bandung : PT. RemajaRosdaKarya.

Nasution, Nochi dan Adi Suryanto. 2008.EvaluasiPenyajian.Jakarta:UniversitasTerbuka.

Suryanto , Adi , dkk . 2012. Evaluas iPembelajaran di SD. TanggerangSelatan:UniversitasTerbuka.

Yamin, Martius, 2006. Serti�ikasi ProfesiKeguruan di Indonesia.Jakarta : CjangPersadaPress.

Zainul,Asnawi&Agus,Mulyana,2003.TesdanAsasmen di SD. Jakarta : UniversitasTerbuka.

Page 110: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

110 111

GURU

PEMBIMBIN

G

KEPALA

SEKOLAH

TEMAN

SEJAWAT

PESERTA

DIDIK

SELURUH

GURU

inova�f

transforma�f

ak�f

reak�f

produk�f

inova�f

transforma�f

ak�f

reak�f

inova�f

ak�f

reak�f

produk�f

inova�f

nomina�f

transforma�f

ak�f

reak�fKeteranganBagan:KoordinasiInstruksi

Gambar 1. Strategi PINTAR PadaPengelolaanEktrakurikuler DiSMPNegeri41Batam

ImplementasiPemecahanMasalah

Pemecahan masalah ekstra-

kurikulerkarya ilmiah,seni lukis,poster,

dan desain batik serta seni kriya dan

sebagainyadilakukanmelaluipenerapan

strategi PINTAR (Produktif, Inovatif,

Nominatif, Transformatif, Aktif dan

Reaktif ). Hasil karya peserta didik

berkembang dengan inovasi yang ada.

Hasil karya dari peserta didik tersebut

diusahakan memiliki kualitas yang baik

sehingga memiliki nilai jual dan bisa

mengikutiberbagaiajangkompetisi.

DenganstrategiPINTARpolapikir

pesertadidikmenjadi berkembanglebih

baik. Para peserta didik mampu men-

transfer kemampuannya kepada peserta

didikyanglainataukepadaoranglain.Hal

itudapatmenjadibekalmerekanantipada

kehidupannya, kegiatan ini mampu

dilaksanakan dengan kegigihan dan

keseriusan dari para peserta didik.

Kegiatan ini dilaksanakan secara lebih

seriusdanbersungguh-sungguh.Strategi

PINTARinidipakaiuntukmendukungdan

mewujudkansertamerealisasikansemua

program yang telah dicanangkan SMP

Negeri41Batam,makasudahtentudalam

pelaksanaan semua itu memerlukan

biaya. Semua kegiatan ini dibiayai oleh

danaBOS(BantuanOperasionalSekolah).

BOSsangatbermanfaatbagisekolahdan

menjadi sumber dana utama bagi

kelangsungan hidup sekolah. Pendanaan

yang ada ini tentu harus dikelola sesuai

juknissertatransparandanakuntabel.

Pemanfaatan dana BOS di SMP

Negeri 41 Batam dilakukan dengan

semaksimal-semaksimalnya sesuai

dengan aturan juknis yang berlaku

sehingga pengelolaan dana BOS yang

meliputi4halyangharusdikerjakanyaitu

perencanaan,pelaksanaan,pelaporandan

output. SMP Negeri 41 Batam telah

mendapatkannominasi yang cukupbaik

pada ajang lomba Tata Kelola BOS di

tingkatnasionalyaitumemperoleh juara

ketigapadatahun2014.

Dana BOS sebagai penggerak

utamasemuakegiatandiSMPNegeri41

Batam yang dari perencanaan harus

dipersiapkan secara matang adminis-

trasinya.Langkahkeduapelaksanaanatau

penggunaandanaBOSdilakukandengan

cermat, hati-hati, dan terbuka terhadap

semuapemangkukepentingan.Danyang

tidak kalah pentingnya adalah me-

ngomunikasikan penggunaan dana BOS

kepada stakeholder sekolah, orang tua,

komitesekolah,danparapesertadidikdi

SMPNegeri41Batam.PendanaanBOSini

merupakan salah satu manajemen

keuangan sekolah yang dalam karya

ilmiahinitidakdibahassecaraterinci.

Penulis sebagai pemimpin pem-

belajaran di SMPNegeri 41 Batam akan

selalu berusaha untuk memotivasi,

memberikandoronganyang tinggi, serta

memfasilitasisehinggakegiatan-kegiatan

yangmenjadi program di sekolah dapat

mencapai hasil yang lebih baik. Segala

ciptacerpendanbacapuisi.Semuaitubelum

dapatdilaksanakansecarabaikdanmaksimal.

Ekstrakurikuler yang diangkat pada

karyainiberangkatdariEvaluasiDiriSekolah

(EDS) SMP Negeri 41 Batam, dimana lebih

memiliki potensi yang baik di bidang non-

akademik dibandingkan bidang akademik,

walaupun bidang akademik juga sudah

dilakukan upaya-upaya untuk peningkatan.

Untuk itu maka pembahasan selanjutnya

adalahmengenaiekstrakurikuleryangdapat

dikembangkandandiunggulkanolehsekolah.

Untuk dapat mengembangkan dan

memperoleh hasil yang lebih baik maka

strategi PINTAR (Produktif, Inovatif,

Nominatif,Transformatif,Aktif,danReaktif)

diterapkanpadapengelolaanekstrakurikuler

di SMP Negeri 41 Batam. Masalah yang

dihadapi oleh SMPNegeri 41 Batam adalah

bahwa hasil kegiatan ekstrakurikuler yang

dilaksanakan oleh SMP Negeri 41 Batam

belum menunjukkan hasil yang baik. Dapat

dikatakan bahwa prestasi non-akademik

pesertadidikdiSMPNegeri41Batammasih

rendah.

Berdasarkan hal tersebut maka

penerapan strategi PINTAR bertujuan

sebagai alternatif untuk meningkatkan

prestasinon-akademikpesertadidikdiSMP

Negeri41Batam.PenerapanstrategiPINTAR

pada pengelolaan ekstrakurikuler di SMP

Negeri 41 Batam bermaksud untuk

meningkatkanprestasinon-akademikpeserta

didikdiSMPNegeri41Batam.

Strategi“PINTAR”

Dalam mewujudkan PINTAR maka

kepala sekolah bersama guru pembina

mendesain langkah-langkahyangdigunakan

untukmenerapkanstrategiPINTARagarhasil

yang diperoleh maksimal. Langkah-langkah

tersebutyaitu:

1. Antara kepala sekolah dengan guru

pembina selalu berkomunikasi terkait

kegiatanekstrakurikulersehinggabilaada

kelemahan atau kesulitan dapat dicari

solusinya.

2.Darigurupembinamemberikanpembinaan

atau bimbingan kepada peserta didik

dengan menerapkan PINTAR untuk

mengembangkan kompetensi yang

dimilikinyasecaramaksimal.

3. Setelahpesertadidikmenguasaikegiatan

ekstrakurikuler yang diikuti, mereka

mentransformasikan kepada teman-

teman sejawat dan guru serta kepala

sekolahmelaluipresentasihasil/produk.

4. Teman-teman sejawat, guru, dan kepala

sekolahmemberikanmasukanatausaran

demi kebaikan hasil/produk yang

dilaksanakanolehpesertadidik.

5. Seluruh guru ikut berpartisipasi dalam

pengembanganekstrakurikuler danjuga

memberikan sarandanmasukankepada

peserta didik, gurupembina, dan kepala

sekolah.

6. Gurupembinamenerimamasukan,saran

dariberbagaipihaktermasukdarikepala

sekolah untuk perbaikan dalam pem-

binaanataubimbinganpadapesertadidik.

Gurupembina,pesertadidik, teman

sejawat, seluruh guru, dan kepala sekolah

secara terbuka berkomunikasi, memotivasi,

danmemfasilitasikegiatanekstrakurikulerdi

SMPNegeri41Batamdansalingmendukung

untuk memperoleh hasil yang terbaik dan

maksimal.Caradanpendekatanpenyelesaian

masalah yang dilakukan sesuai dengan

strategiPINTAR.

Page 111: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

110 111

GURU

PEMBIMBIN

G

KEPALA

SEKOLAH

TEMAN

SEJAWAT

PESERTA

DIDIK

SELURUH

GURU

inova�f

transforma�f

ak�f

reak�f

produk�f

inova�f

transforma�f

ak�f

reak�f

inova�f

ak�f

reak�f

produk�f

inova�f

nomina�f

transforma�f

ak�f

reak�fKeteranganBagan:KoordinasiInstruksi

Gambar 1. Strategi PINTAR PadaPengelolaanEktrakurikuler DiSMPNegeri41Batam

ImplementasiPemecahanMasalah

Pemecahan masalah ekstra-

kurikulerkarya ilmiah,seni lukis,poster,

dan desain batik serta seni kriya dan

sebagainyadilakukanmelaluipenerapan

strategi PINTAR (Produktif, Inovatif,

Nominatif, Transformatif, Aktif dan

Reaktif ). Hasil karya peserta didik

berkembang dengan inovasi yang ada.

Hasil karya dari peserta didik tersebut

diusahakan memiliki kualitas yang baik

sehingga memiliki nilai jual dan bisa

mengikutiberbagaiajangkompetisi.

DenganstrategiPINTARpolapikir

pesertadidikmenjadi berkembanglebih

baik. Para peserta didik mampu men-

transfer kemampuannya kepada peserta

didikyanglainataukepadaoranglain.Hal

itudapatmenjadibekalmerekanantipada

kehidupannya, kegiatan ini mampu

dilaksanakan dengan kegigihan dan

keseriusan dari para peserta didik.

Kegiatan ini dilaksanakan secara lebih

seriusdanbersungguh-sungguh.Strategi

PINTARinidipakaiuntukmendukungdan

mewujudkansertamerealisasikansemua

program yang telah dicanangkan SMP

Negeri41Batam,makasudahtentudalam

pelaksanaan semua itu memerlukan

biaya. Semua kegiatan ini dibiayai oleh

danaBOS(BantuanOperasionalSekolah).

BOSsangatbermanfaatbagisekolahdan

menjadi sumber dana utama bagi

kelangsungan hidup sekolah. Pendanaan

yang ada ini tentu harus dikelola sesuai

juknissertatransparandanakuntabel.

Pemanfaatan dana BOS di SMP

Negeri 41 Batam dilakukan dengan

semaksimal-semaksimalnya sesuai

dengan aturan juknis yang berlaku

sehingga pengelolaan dana BOS yang

meliputi4halyangharusdikerjakanyaitu

perencanaan,pelaksanaan,pelaporandan

output. SMP Negeri 41 Batam telah

mendapatkannominasi yang cukupbaik

pada ajang lomba Tata Kelola BOS di

tingkatnasionalyaitumemperoleh juara

ketigapadatahun2014.

Dana BOS sebagai penggerak

utamasemuakegiatandiSMPNegeri41

Batam yang dari perencanaan harus

dipersiapkan secara matang adminis-

trasinya.Langkahkeduapelaksanaanatau

penggunaandanaBOSdilakukandengan

cermat, hati-hati, dan terbuka terhadap

semuapemangkukepentingan.Danyang

tidak kalah pentingnya adalah me-

ngomunikasikan penggunaan dana BOS

kepada stakeholder sekolah, orang tua,

komitesekolah,danparapesertadidikdi

SMPNegeri41Batam.PendanaanBOSini

merupakan salah satu manajemen

keuangan sekolah yang dalam karya

ilmiahinitidakdibahassecaraterinci.

Penulis sebagai pemimpin pem-

belajaran di SMPNegeri 41 Batam akan

selalu berusaha untuk memotivasi,

memberikandoronganyang tinggi, serta

memfasilitasisehinggakegiatan-kegiatan

yangmenjadi program di sekolah dapat

mencapai hasil yang lebih baik. Segala

ciptacerpendanbacapuisi.Semuaitubelum

dapatdilaksanakansecarabaikdanmaksimal.

Ekstrakurikuler yang diangkat pada

karyainiberangkatdariEvaluasiDiriSekolah

(EDS) SMP Negeri 41 Batam, dimana lebih

memiliki potensi yang baik di bidang non-

akademik dibandingkan bidang akademik,

walaupun bidang akademik juga sudah

dilakukan upaya-upaya untuk peningkatan.

Untuk itu maka pembahasan selanjutnya

adalahmengenaiekstrakurikuleryangdapat

dikembangkandandiunggulkanolehsekolah.

Untuk dapat mengembangkan dan

memperoleh hasil yang lebih baik maka

strategi PINTAR (Produktif, Inovatif,

Nominatif,Transformatif,Aktif,danReaktif)

diterapkanpadapengelolaanekstrakurikuler

di SMP Negeri 41 Batam. Masalah yang

dihadapi oleh SMPNegeri 41 Batam adalah

bahwa hasil kegiatan ekstrakurikuler yang

dilaksanakan oleh SMP Negeri 41 Batam

belum menunjukkan hasil yang baik. Dapat

dikatakan bahwa prestasi non-akademik

pesertadidikdiSMPNegeri41Batammasih

rendah.

Berdasarkan hal tersebut maka

penerapan strategi PINTAR bertujuan

sebagai alternatif untuk meningkatkan

prestasinon-akademikpesertadidikdiSMP

Negeri41Batam.PenerapanstrategiPINTAR

pada pengelolaan ekstrakurikuler di SMP

Negeri 41 Batam bermaksud untuk

meningkatkanprestasinon-akademikpeserta

didikdiSMPNegeri41Batam.

Strategi“PINTAR”

Dalam mewujudkan PINTAR maka

kepala sekolah bersama guru pembina

mendesain langkah-langkahyangdigunakan

untukmenerapkanstrategiPINTARagarhasil

yang diperoleh maksimal. Langkah-langkah

tersebutyaitu:

1. Antara kepala sekolah dengan guru

pembina selalu berkomunikasi terkait

kegiatanekstrakurikulersehinggabilaada

kelemahan atau kesulitan dapat dicari

solusinya.

2.Darigurupembinamemberikanpembinaan

atau bimbingan kepada peserta didik

dengan menerapkan PINTAR untuk

mengembangkan kompetensi yang

dimilikinyasecaramaksimal.

3. Setelahpesertadidikmenguasaikegiatan

ekstrakurikuler yang diikuti, mereka

mentransformasikan kepada teman-

teman sejawat dan guru serta kepala

sekolahmelaluipresentasihasil/produk.

4. Teman-teman sejawat, guru, dan kepala

sekolahmemberikanmasukanatausaran

demi kebaikan hasil/produk yang

dilaksanakanolehpesertadidik.

5. Seluruh guru ikut berpartisipasi dalam

pengembanganekstrakurikuler danjuga

memberikan sarandanmasukankepada

peserta didik, gurupembina, dan kepala

sekolah.

6. Gurupembinamenerimamasukan,saran

dariberbagaipihaktermasukdarikepala

sekolah untuk perbaikan dalam pem-

binaanataubimbinganpadapesertadidik.

Gurupembina,pesertadidik, teman

sejawat, seluruh guru, dan kepala sekolah

secara terbuka berkomunikasi, memotivasi,

danmemfasilitasikegiatanekstrakurikulerdi

SMPNegeri41Batamdansalingmendukung

untuk memperoleh hasil yang terbaik dan

maksimal.Caradanpendekatanpenyelesaian

masalah yang dilakukan sesuai dengan

strategiPINTAR.

Page 112: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

112 113

(transformatif).

h. Mengembangkan hasil eksplorasi

daneksprimendengan membuat

komposisi bidang, bentuk, dan

warnadalamsuatukaryasenilukis

denganpraktik(produktif).

i. Menggambar model �lora dan

faunamelaluipraktik(produktif).

j. Menggambar alam benda dengan

praktik(produktif).

k. Melukis objek pemandangan

suasana pagi atau siang hari

denganpraktik(produktif).

l. Melukis objek pemandangan

suasana senja atau sore hari

denganpraktik(produktif).

m. Mengenal objek manusia melalui

tayangandanpraktikmenggambar

(aktif, transformatif, inovatif, dan

produktif).

n. Mengenalgerakmanusiatayangan

dan praktik menggambar (aktif,

inovatif,produktif).

o. Membuatlukisanbertemamelalui

praktik(aktif,produktif).

p. Evaluasi(apresiasikarya).

3. KegiatanEkstrakurikulerKaryaIlmiah

a. Peserta didik menuliskan ide/

topik kajian penelitian atau

penulisan sebanyak-banyaknya

berdasarkan bidang lomba pada

buku catatan harian (aktif). Guru

membantu menetapkan ide-ide

penelitian sehingga peserta didik

segera bisa mulai menulis dan

melakukan percobaan/penelitian

(inovatif).

b. Peserta didik dikelompokkan

dengan masing-masing kelompok

terdiridariduaorang(heterogen).

c. Menetapkan kerangka acuan atau

outline penulisan.Mengumpulkan

bahan pustaka/referensi dari

berbagai sumber seperti buku,

majalah,koran,jurnaldaninternet.

d. Peserta didik melakukan praktik

menulis terbimbing berdasarkan

teori-teori penulisan atau pe-

nelitian(produktif).

e. Peserta didik melaksanakan pe-

nelitiansesuaidenganmetodeatau

prosedur penelitian yang telah

ditetapkan.Padaprosespenelitian

ini siswa diarahkan untuk me-

ngumpulkan data sesuai dengan

metode pengumpulan data dan

mendokumentasikan hasil pe-

nelitianbaikdalambentukgambar,

modelmaupunfoto.

f. Peserta didik untuk melakukan

analisis data dengan teknik yang

telahditetapkan(inovatif).

g. Bagian yang tidak kalah pe-

ntingnya adalah membimbing

peserta didik untuk menuliskan

bagian-bagian atau sistematika

karyailmiah.

h. Mengedituntukmengoreksisubs-

tansi. Jika masih kurang perlu

ditambah tulisan, jika ada ke-

lebihan (yang tidak diperlukan)

maka bisa dihilangkan, dipin-

dahkan, atau diganti. Menam-

bahkan kutipan ataumenguatkan

denganberbagaireferensi(aktif).

i. Mengedit tata tulis yangmeliputi

ejaanyangdisempurnakan(EYD),

tata tulis (penomoran, kutipan,

penamaan tabel, diagram, daftar

pustakadansebagainya)

j. Meminta pendapat kepada ahli

daya dan upaya tetap selalu diusahakan

demimeraihsuatukeberhasilan.

Implementasi cara pemecahan

masalah untuk ketiga contoh ekstra-

kurikuler dengan menggunakan strategi

PINTARadalahsebagaiberikut:

1. KegiatanEkstrakurikulerSeniKriya

a. Pada awal pertemuan, peserta

didik di berikan materi tentang

jeniskerajinantanganberdasarkan

temuan-temuan baru dengan

bahan baku dari alam dan cara

pembuatannya transformatif,

inovatif).

b. Kemudianpadapertemuankedua,

peserta didik sudah mulai mem-

praktikan materi yang sudah di

berikan pada awal pertemuan.

Diawalidenganpembuatandesain

yang dicontohkan oleh pem-

bimbingdanolehpesertadidikitu

sendiri(produktif,reaktif).

c. Peserta didik yang sudah mahir

dapat dijadikan model untuk

mewakil i guru pembimbing

mengajarkan cara pembuatan

kerajinankepadateman-temannya

(transformatif).

d. Untuk bahan-bahan pembuatan

kerajinan tangan (kriya) akan di

sediakanolehpihaksekolah.

e. Praktik pembuatan kriya di

laksanakan di SMP Negeri 41

Batam setiap seminggu sekali di

hari Sabtu secara rutin dan di

laksanakan secara berkelompok

maupun individu (produktif,

inovatif).

f. Hasil pembuatan kriya akan di

kemas dengan plastik berlabel

dengantujuanagar lebihmenarik

danmemilikidayajual.Kemudian

akan di pasarkan pada saat ada

eventsepertibazartingkatsekolah,

kotabahkanditingkatprovinsidan

untuk event lomba (nominatif,

reaktif).

g. Hasilpenjualankriyaakanmasuk

ke kas ekstrakurikuler kriya

sebagai pembelian bahan-bahan

kriya yang akan di praktikan

mendatang.

h. Pada saat ujian ekstrakurikuler,

setiap peserta didik harus

membentuk kelompok untuk

mempraktikan pembuatan kriya

yangtelahdiajarkan.

2. KegiatanEkstrakurikulerSeniRupa:

a. Mengenalkan berbagai jenis

lukisan karya pelukis-pelukis

terkenalbaikdalammaupun luar

negeri lewat tayangan video

infokus(transformatif).

b. Pengenalanunsur-unsursenirupa

lewat tayanganmaupunperagaan

langsung(transformatif).

c. Pengenalan prinsip-prinsip es-

tetika (komposisi, balance, irama,

vocal point, dll) lewat tayangan

maupun alat peraga (trans-

formatif).

d. Pengenalan bahan dan teknik

menggambar melalui tayangan

dan peragaan langsung (trans-

formatif).

e. Eksplorasi jenis-jenis garis me-

lalui praktik dengan pena (pro-

duktif).

f. Eksplorasi bentuk dan bidang

denganpraktik(produktif).

g. Pengenalan dan eksplorasiwarna

melalui tayangan dan praktik

Page 113: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

112 113

(transformatif).

h. Mengembangkan hasil eksplorasi

daneksprimendengan membuat

komposisi bidang, bentuk, dan

warnadalamsuatukaryasenilukis

denganpraktik(produktif).

i. Menggambar model �lora dan

faunamelaluipraktik(produktif).

j. Menggambar alam benda dengan

praktik(produktif).

k. Melukis objek pemandangan

suasana pagi atau siang hari

denganpraktik(produktif).

l. Melukis objek pemandangan

suasana senja atau sore hari

denganpraktik(produktif).

m. Mengenal objek manusia melalui

tayangandanpraktikmenggambar

(aktif, transformatif, inovatif, dan

produktif).

n. Mengenalgerakmanusiatayangan

dan praktik menggambar (aktif,

inovatif,produktif).

o. Membuatlukisanbertemamelalui

praktik(aktif,produktif).

p. Evaluasi(apresiasikarya).

3. KegiatanEkstrakurikulerKaryaIlmiah

a. Peserta didik menuliskan ide/

topik kajian penelitian atau

penulisan sebanyak-banyaknya

berdasarkan bidang lomba pada

buku catatan harian (aktif). Guru

membantu menetapkan ide-ide

penelitian sehingga peserta didik

segera bisa mulai menulis dan

melakukan percobaan/penelitian

(inovatif).

b. Peserta didik dikelompokkan

dengan masing-masing kelompok

terdiridariduaorang(heterogen).

c. Menetapkan kerangka acuan atau

outline penulisan.Mengumpulkan

bahan pustaka/referensi dari

berbagai sumber seperti buku,

majalah,koran,jurnaldaninternet.

d. Peserta didik melakukan praktik

menulis terbimbing berdasarkan

teori-teori penulisan atau pe-

nelitian(produktif).

e. Peserta didik melaksanakan pe-

nelitiansesuaidenganmetodeatau

prosedur penelitian yang telah

ditetapkan.Padaprosespenelitian

ini siswa diarahkan untuk me-

ngumpulkan data sesuai dengan

metode pengumpulan data dan

mendokumentasikan hasil pe-

nelitianbaikdalambentukgambar,

modelmaupunfoto.

f. Peserta didik untuk melakukan

analisis data dengan teknik yang

telahditetapkan(inovatif).

g. Bagian yang tidak kalah pe-

ntingnya adalah membimbing

peserta didik untuk menuliskan

bagian-bagian atau sistematika

karyailmiah.

h. Mengedituntukmengoreksisubs-

tansi. Jika masih kurang perlu

ditambah tulisan, jika ada ke-

lebihan (yang tidak diperlukan)

maka bisa dihilangkan, dipin-

dahkan, atau diganti. Menam-

bahkan kutipan ataumenguatkan

denganberbagaireferensi(aktif).

i. Mengedit tata tulis yangmeliputi

ejaanyangdisempurnakan(EYD),

tata tulis (penomoran, kutipan,

penamaan tabel, diagram, daftar

pustakadansebagainya)

j. Meminta pendapat kepada ahli

daya dan upaya tetap selalu diusahakan

demimeraihsuatukeberhasilan.

Implementasi cara pemecahan

masalah untuk ketiga contoh ekstra-

kurikuler dengan menggunakan strategi

PINTARadalahsebagaiberikut:

1. KegiatanEkstrakurikulerSeniKriya

a. Pada awal pertemuan, peserta

didik di berikan materi tentang

jeniskerajinantanganberdasarkan

temuan-temuan baru dengan

bahan baku dari alam dan cara

pembuatannya transformatif,

inovatif).

b. Kemudianpadapertemuankedua,

peserta didik sudah mulai mem-

praktikan materi yang sudah di

berikan pada awal pertemuan.

Diawalidenganpembuatandesain

yang dicontohkan oleh pem-

bimbingdanolehpesertadidikitu

sendiri(produktif,reaktif).

c. Peserta didik yang sudah mahir

dapat dijadikan model untuk

mewakil i guru pembimbing

mengajarkan cara pembuatan

kerajinankepadateman-temannya

(transformatif).

d. Untuk bahan-bahan pembuatan

kerajinan tangan (kriya) akan di

sediakanolehpihaksekolah.

e. Praktik pembuatan kriya di

laksanakan di SMP Negeri 41

Batam setiap seminggu sekali di

hari Sabtu secara rutin dan di

laksanakan secara berkelompok

maupun individu (produktif,

inovatif).

f. Hasil pembuatan kriya akan di

kemas dengan plastik berlabel

dengantujuanagar lebihmenarik

danmemilikidayajual.Kemudian

akan di pasarkan pada saat ada

eventsepertibazartingkatsekolah,

kotabahkanditingkatprovinsidan

untuk event lomba (nominatif,

reaktif).

g. Hasilpenjualankriyaakanmasuk

ke kas ekstrakurikuler kriya

sebagai pembelian bahan-bahan

kriya yang akan di praktikan

mendatang.

h. Pada saat ujian ekstrakurikuler,

setiap peserta didik harus

membentuk kelompok untuk

mempraktikan pembuatan kriya

yangtelahdiajarkan.

2. KegiatanEkstrakurikulerSeniRupa:

a. Mengenalkan berbagai jenis

lukisan karya pelukis-pelukis

terkenalbaikdalammaupun luar

negeri lewat tayangan video

infokus(transformatif).

b. Pengenalanunsur-unsursenirupa

lewat tayanganmaupunperagaan

langsung(transformatif).

c. Pengenalan prinsip-prinsip es-

tetika (komposisi, balance, irama,

vocal point, dll) lewat tayangan

maupun alat peraga (trans-

formatif).

d. Pengenalan bahan dan teknik

menggambar melalui tayangan

dan peragaan langsung (trans-

formatif).

e. Eksplorasi jenis-jenis garis me-

lalui praktik dengan pena (pro-

duktif).

f. Eksplorasi bentuk dan bidang

denganpraktik(produktif).

g. Pengenalan dan eksplorasiwarna

melalui tayangan dan praktik

Page 114: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

114 115

PINTAR pada ekstrakurikuler seni kriya,

seni rupa, dan karya ilmiah maka SMP

negeri41Batamberusahamenghidupkan

n i la i yang pos i t i f ya i tu dengan

mengembangkan dan mengintensi�kan

ekstrakurikuler tersebut. Untuk lebih

memotivasi ekstrakurikuler seni kriya

maka pada saat-saat tertentu diadakan

bazar, ekspo, dan momen-momen lain

untuk mengaktualisasikan program ter-

sebut dan menggairahkan kegiatan

tersebut.SelainituSMPNegeri41Batam

berusaha menggandeng institusi yang

berkompeten di bidang kewirausahaan

misalnya Dekranasda, Disperindag, dan

kelompokkerjalainnyayangmemilikivisi

dan misi yang sama yaitu mengem-

bangkan hal tersebut walaupun dalam

lingkupyangmasihkecil.

Semua ini dilakukan dengan

maksud untuk menanamkan jiwa dan

semangat berkompetisi dan berusaha

pada peserta didik khususnya dan guru

serta warga sekolah pada umumnya

untuk mampu mengembangkan potensi

dirinyadankelakdapatditerapkandalam

kehidupannya.

Kegiatan yang dikembangkan di

SMP Negeri 41 Batam cukup banyak

diantaranya seni kriya, seni rupa, karya

ilmiah,senimusik,seni tari,vocalgroup,

kompang, kaligra�i, cerdas cermat,

olimpiodesain,danlain-lain.

Dari ekstrakurikuler yang ada

maka sebagai contoh adalah seni kriya,

senirupayangmeliputisenilukis,poster,

dandesainmotif batik,dankaryailmiah

dengan alasan SMP Negeri 41 Batam

memilikipotensikeunggulankompetensi

pembinayangbaik sebagaisumberdaya

utama.

Sedangkan untuk seni rupa baik

lukis,poster,dandesainbatikjugasangat

memerlukanpenangananpengembangan,

pembimbingan,pembinaanyang intensif

sehingga diharapkan memberikan hasil

yanglebihbaikdarisebelumnya.Dengan

penerapan strategi PINTAR, ekstra-

kurikuler seni rupa di SMP Negeri 41

akhirnyamampumemperolehhasilyang

baik dari tingkat kota, tingkat provinsi

bahkan di tingkat nasional untuk seni

lukis,poster,dandesainmotifbatik.

Selain itu juga pengembangan

penulisan karya ilmiah. Dengan strategi

PINTAR pengembangan karya ilmiah ini

dilakukanpelatihanmenulisyangdimulai

dari tahapan yang paling mudah dan

palingsederhana.

HasilImplementasi

Dari yang diuraikan di atasmaka

terwujud apa yang disebut dengan

strategi PINTAR (Produktif, Inovatif,No-

minatif,Transformatif,Aktif,danReaktif).

Dengan strategi itu setiap program dan

kegiatanharusdidasarkanpadaPINTAR,

sehinggamembuahkanhasildidikanyang

pintarjuga.DenganstrategiPINTAR,SMP

Negeri 41 Batam sudah pernah meraih

sukses yang cukup gemilang sampai ke

tingkatnasionalyaitubidang:

1. Seni kriya yang diwujudkan

dengan lomba kewirausahaan men-

capai juara harapan satu di tingkat

nasional.

2. Senirupayangmeliputisenilukis,

desainmotif batik, dan poster sudah

mendapatkan juara di tingkat na-

sional. Juara harapan tiga di tingkat

nasional untuk desain motif batik

yang diadakan di istana negara

(expert judgment) seperti guru

Bahasa Indonesia. Walaupun

hanya sekilas, saran, pendapat,

atau kritik dari ahli dan teman

sejawatsangatlahpenting.

k. Langkah ini mendeskripsikan

bagaimana membimbing peserta

didik untuk siap berkompetisi,

siaptampildidepanpublikataudi

depan dewan jurimelalui latihan

presentasidantanyajawab(nomi-

natif). Tahap ini sangat penting

karena siswa memiliki kecen-

derungan untuk malu berbicara

sehingga keterampilan berbicara

kurang.

KelebihanEkstrakurikulerSeniKriya,

SeniRupa,danKaryaIlmiah

Kelebihan ekstrakulikuler yang

dilaksanakan di SMP Negeri 41 Batam

yaitusebagaiberikut:

1. Melatihpesertadidikuntukmemiliki

semangat yang baik dan selalu

produktifpadabidangmasing-masing

sesuaidengankompetensi.

2. Melatih peserta didik untuk selalu

memiliki jiwa inovatif dalam bidang

masing-masing sesuai dengan kom-

petensi.

3. Ajang untuk mempersiapkan diri

menjadi pribadi yang memiliki jiwa

kompetitif dan mendapatkan nomi-

natifdalamsetiapajangperlombaan.

4.Kegiatanyangdiadakanbisamencetak

pribadiyangtransformatif.

5.Melatihpesertadidikuntukaktifdalam

mengembangkankompetensimasing-

masing.

6.Melatihpesertadidikuntukreaktifatau

tanggap terhadap segala hal dalam

mengembangkan kompetensi yang

dimilikinya.

HASIL DAN PEMBAHASAN

Strategi PINTAR dipakai sebagai

upaya mengatasi permasalahan khu-

susnyaekstrakurikulerdiSMPNegeri41

Batam. Kegiatan ekstrakurikuler ini diu-

payakandenganmemberikanbimbingan,

pelatihan, dan pendampingan secara

terus-menerus dan terjadwal sesuai

denganprogramyangtelahdicanangkan.

Beberapa ekstrakurikuler misal-

nya karya ilmiah, seni lukis, poster, dan

desainbatiksertasenikriyayangdiikuti

olehpesertadidik yangjumlahnyarelatif

sedikit dengan penerapan strategi

PINTARmampumeningkatkanjumlahnya

dan hasilnya menunjukkan suatu pe-

ningkatan. Sebagai contoh pelaksanaan

pembinaan ekstrakurikuler karya ilmiah

ini dengan cara membimbing, melatih,

danmemberikan pendampingan kepada

peserta didik secara intensif dan terus

menerussesuaijadwalyangtelahdibuat.

Strategi yang diterapkan oleh

penulisadalahmelakukanpembimbingan

dan pendampingan kepada guru dan

peserta didik dengan strategi PINTAR

dalam mengembangkan kemampuannya

pada program kegiatan, melaksanakan

kegiatan,melaporkankegiatan,danhasil

yang dicapai pada setiap kegiatan

ekstrakurikuler.

Strategi PINTAR diterapkan

sehinggahasilyangdicapaimenjadilebih

maksimal. Proses pembimbingan atau

pendampingan harus berlangsung lebih

produktif, inovatif, nominatif, trans-

formatif,aktif,danreaktif.

Dengan diterapkannya strategi

Page 115: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

114 115

PINTAR pada ekstrakurikuler seni kriya,

seni rupa, dan karya ilmiah maka SMP

negeri41Batamberusahamenghidupkan

n i la i yang pos i t i f ya i tu dengan

mengembangkan dan mengintensi�kan

ekstrakurikuler tersebut. Untuk lebih

memotivasi ekstrakurikuler seni kriya

maka pada saat-saat tertentu diadakan

bazar, ekspo, dan momen-momen lain

untuk mengaktualisasikan program ter-

sebut dan menggairahkan kegiatan

tersebut.SelainituSMPNegeri41Batam

berusaha menggandeng institusi yang

berkompeten di bidang kewirausahaan

misalnya Dekranasda, Disperindag, dan

kelompokkerjalainnyayangmemilikivisi

dan misi yang sama yaitu mengem-

bangkan hal tersebut walaupun dalam

lingkupyangmasihkecil.

Semua ini dilakukan dengan

maksud untuk menanamkan jiwa dan

semangat berkompetisi dan berusaha

pada peserta didik khususnya dan guru

serta warga sekolah pada umumnya

untuk mampu mengembangkan potensi

dirinyadankelakdapatditerapkandalam

kehidupannya.

Kegiatan yang dikembangkan di

SMP Negeri 41 Batam cukup banyak

diantaranya seni kriya, seni rupa, karya

ilmiah,senimusik,seni tari,vocalgroup,

kompang, kaligra�i, cerdas cermat,

olimpiodesain,danlain-lain.

Dari ekstrakurikuler yang ada

maka sebagai contoh adalah seni kriya,

senirupayangmeliputisenilukis,poster,

dandesainmotif batik,dankaryailmiah

dengan alasan SMP Negeri 41 Batam

memilikipotensikeunggulankompetensi

pembinayangbaik sebagaisumberdaya

utama.

Sedangkan untuk seni rupa baik

lukis,poster,dandesainbatikjugasangat

memerlukanpenangananpengembangan,

pembimbingan,pembinaanyang intensif

sehingga diharapkan memberikan hasil

yanglebihbaikdarisebelumnya.Dengan

penerapan strategi PINTAR, ekstra-

kurikuler seni rupa di SMP Negeri 41

akhirnyamampumemperolehhasilyang

baik dari tingkat kota, tingkat provinsi

bahkan di tingkat nasional untuk seni

lukis,poster,dandesainmotifbatik.

Selain itu juga pengembangan

penulisan karya ilmiah. Dengan strategi

PINTAR pengembangan karya ilmiah ini

dilakukanpelatihanmenulisyangdimulai

dari tahapan yang paling mudah dan

palingsederhana.

HasilImplementasi

Dari yang diuraikan di atasmaka

terwujud apa yang disebut dengan

strategi PINTAR (Produktif, Inovatif,No-

minatif,Transformatif,Aktif,danReaktif).

Dengan strategi itu setiap program dan

kegiatanharusdidasarkanpadaPINTAR,

sehinggamembuahkanhasildidikanyang

pintarjuga.DenganstrategiPINTAR,SMP

Negeri 41 Batam sudah pernah meraih

sukses yang cukup gemilang sampai ke

tingkatnasionalyaitubidang:

1. Seni kriya yang diwujudkan

dengan lomba kewirausahaan men-

capai juara harapan satu di tingkat

nasional.

2. Senirupayangmeliputisenilukis,

desainmotif batik, dan poster sudah

mendapatkan juara di tingkat na-

sional. Juara harapan tiga di tingkat

nasional untuk desain motif batik

yang diadakan di istana negara

(expert judgment) seperti guru

Bahasa Indonesia. Walaupun

hanya sekilas, saran, pendapat,

atau kritik dari ahli dan teman

sejawatsangatlahpenting.

k. Langkah ini mendeskripsikan

bagaimana membimbing peserta

didik untuk siap berkompetisi,

siaptampildidepanpublikataudi

depan dewan jurimelalui latihan

presentasidantanyajawab(nomi-

natif). Tahap ini sangat penting

karena siswa memiliki kecen-

derungan untuk malu berbicara

sehingga keterampilan berbicara

kurang.

KelebihanEkstrakurikulerSeniKriya,

SeniRupa,danKaryaIlmiah

Kelebihan ekstrakulikuler yang

dilaksanakan di SMP Negeri 41 Batam

yaitusebagaiberikut:

1. Melatihpesertadidikuntukmemiliki

semangat yang baik dan selalu

produktifpadabidangmasing-masing

sesuaidengankompetensi.

2. Melatih peserta didik untuk selalu

memiliki jiwa inovatif dalam bidang

masing-masing sesuai dengan kom-

petensi.

3. Ajang untuk mempersiapkan diri

menjadi pribadi yang memiliki jiwa

kompetitif dan mendapatkan nomi-

natifdalamsetiapajangperlombaan.

4.Kegiatanyangdiadakanbisamencetak

pribadiyangtransformatif.

5.Melatihpesertadidikuntukaktifdalam

mengembangkankompetensimasing-

masing.

6.Melatihpesertadidikuntukreaktifatau

tanggap terhadap segala hal dalam

mengembangkan kompetensi yang

dimilikinya.

HASIL DAN PEMBAHASAN

Strategi PINTAR dipakai sebagai

upaya mengatasi permasalahan khu-

susnyaekstrakurikulerdiSMPNegeri41

Batam. Kegiatan ekstrakurikuler ini diu-

payakandenganmemberikanbimbingan,

pelatihan, dan pendampingan secara

terus-menerus dan terjadwal sesuai

denganprogramyangtelahdicanangkan.

Beberapa ekstrakurikuler misal-

nya karya ilmiah, seni lukis, poster, dan

desainbatiksertasenikriyayangdiikuti

olehpesertadidik yangjumlahnyarelatif

sedikit dengan penerapan strategi

PINTARmampumeningkatkanjumlahnya

dan hasilnya menunjukkan suatu pe-

ningkatan. Sebagai contoh pelaksanaan

pembinaan ekstrakurikuler karya ilmiah

ini dengan cara membimbing, melatih,

danmemberikan pendampingan kepada

peserta didik secara intensif dan terus

menerussesuaijadwalyangtelahdibuat.

Strategi yang diterapkan oleh

penulisadalahmelakukanpembimbingan

dan pendampingan kepada guru dan

peserta didik dengan strategi PINTAR

dalam mengembangkan kemampuannya

pada program kegiatan, melaksanakan

kegiatan,melaporkankegiatan,danhasil

yang dicapai pada setiap kegiatan

ekstrakurikuler.

Strategi PINTAR diterapkan

sehinggahasilyangdicapaimenjadilebih

maksimal. Proses pembimbingan atau

pendampingan harus berlangsung lebih

produktif, inovatif, nominatif, trans-

formatif,aktif,danreaktif.

Dengan diterapkannya strategi

Page 116: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

116 117

NOMINATIF

TRANSFORMATIF

SIMPULAN DAN SARAN

Simpulan

Dari uraian di atas dapat disim-

pulkanbahwadenganPenerapanStrategi

PINTAR pada pengelolaan ekstra-

kurikuler dapat meningkatkan prestasi

non-akademik peserta didik di SMP

Cipanas, juara harapan dua tingkat

nasional untuk lomba poster yang

diadakandiPalembang,danuntukseni

lukis sebagai utusan provinsi Ke-

pulauanRiauketingkatnasionalyang

akandilaksanakantahun2016.

3. Karyailmiahsudahpernahmengikuti

sampai ke tingkat nasional sebagai

�inalis dalam lomba sanitasi ling-

kungan yang diadakan oleh dinas

Pekerjaan Umum. Dan untuk tahun

2016inilombamelukisakanmewakili

KepulauanRiauketingkatnasional.

Dari ketiga ekstrakurikuler tadi

selain memperoleh prestasi yang cukup

baik di nasional. SMP Negeri 41 Batam

juga sudah beberapa kali menjadi

perwakilan provinsi Kepulauan Riau ke

tingkatnasional.

Dengan adanya tindakan yang

konstruktif, imaginatif, kreatif dari

individu didalam suatu organisasi,maka

diharapkan akan dapat meningkatkan

produktivitas. Kegiatan produktif con-

tohnya seperti mengadakan kegiatan

ekonomidengancaramelaksanakanbazar

baik di lingkungan sekolah atau tingkat

kota, dan mengikuti bazar/gebyar pada

kegiatan sekolah inklusi di tingkat

provinsi dan nasional. Ini dilakukan

dengan menggandeng institusi yang

berkompeten di bidang kewirausahaan

misalnya Dekranasda, Disperindag, dan

kelompokkerjalainnyayangmemilikivisi

dan misi yang hampir sama. Hasil-hasil

produktif dapat dilihat pada lampiran 1.

Untuk perolehan hasil nominatif yaitu

SMP Negeri 41 Batam telah meraih

prestasi dalam bidang non-akademik

dapatdilihatpadalampiran2.Sedangkan

untukperwujudandariProduktif,Inovatif,

Nominatif, Transformatif, Aktif, dan

Reaktifdapatdilihatsebagaiberikut.

KARYA PRODUKTIF, INOVATIF, AKTIF,

DANREAKTIF

Page 117: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

116 117

NOMINATIF

TRANSFORMATIF

SIMPULAN DAN SARAN

Simpulan

Dari uraian di atas dapat disim-

pulkanbahwadenganPenerapanStrategi

PINTAR pada pengelolaan ekstra-

kurikuler dapat meningkatkan prestasi

non-akademik peserta didik di SMP

Cipanas, juara harapan dua tingkat

nasional untuk lomba poster yang

diadakandiPalembang,danuntukseni

lukis sebagai utusan provinsi Ke-

pulauanRiauketingkatnasionalyang

akandilaksanakantahun2016.

3. Karyailmiahsudahpernahmengikuti

sampai ke tingkat nasional sebagai

�inalis dalam lomba sanitasi ling-

kungan yang diadakan oleh dinas

Pekerjaan Umum. Dan untuk tahun

2016inilombamelukisakanmewakili

KepulauanRiauketingkatnasional.

Dari ketiga ekstrakurikuler tadi

selain memperoleh prestasi yang cukup

baik di nasional. SMP Negeri 41 Batam

juga sudah beberapa kali menjadi

perwakilan provinsi Kepulauan Riau ke

tingkatnasional.

Dengan adanya tindakan yang

konstruktif, imaginatif, kreatif dari

individu didalam suatu organisasi,maka

diharapkan akan dapat meningkatkan

produktivitas. Kegiatan produktif con-

tohnya seperti mengadakan kegiatan

ekonomidengancaramelaksanakanbazar

baik di lingkungan sekolah atau tingkat

kota, dan mengikuti bazar/gebyar pada

kegiatan sekolah inklusi di tingkat

provinsi dan nasional. Ini dilakukan

dengan menggandeng institusi yang

berkompeten di bidang kewirausahaan

misalnya Dekranasda, Disperindag, dan

kelompokkerjalainnyayangmemilikivisi

dan misi yang hampir sama. Hasil-hasil

produktif dapat dilihat pada lampiran 1.

Untuk perolehan hasil nominatif yaitu

SMP Negeri 41 Batam telah meraih

prestasi dalam bidang non-akademik

dapatdilihatpadalampiran2.Sedangkan

untukperwujudandariProduktif,Inovatif,

Nominatif, Transformatif, Aktif, dan

Reaktifdapatdilihatsebagaiberikut.

KARYA PRODUKTIF, INOVATIF, AKTIF,

DANREAKTIF

Page 118: PENINGKATAN KETERAMPILAN SENAM LANTAI GULING ......lapangan multiguna yg digunakan untuk bola basket, futsal, dan bola voli ditambah lagi adanya siswa kelas X dan XI yang sedang melakukan

118 117

Negeri41Batam.

Dengan strategi PINTAR mampu

menghasilkan peserta didik yang pro-

duktif, inovatif, nominatif, transformatif,

aktif, dan reaktif. Setelah diterapkan

strategi PINTAR yang difasilitasi

pendanaannya dari dana BOS, terbukti

telahmampumemperolehhasilyangbaik

di tingkat kota, tingkat provinsi, dan

tingkatnasional.

Saran

1. Strategi PINTAR menjadi acuan

untuk kegiatan-kegiatan mendatang

padasekolah.

2. Strategi PINTAR meningkatkan

kemampuandanpemahamanpeserta

didik dalam mengembangkan kom-

petensinya.StrategiPINTARmembuat

peserta didik terlatih pada kegiatan

non-akademik.

3. Startegi PINTAR meningkatkan

motivasigurudalammengembangkan

kemampuanyangdimilikiolehpeserta

didik.

DAFTAR PUSTAKA

Departemen Pendidikan Nasional. 2008.Kamus Besar Bahasa IndonesiaPusat Bahasa Edisi Keempat.Jakarta.GramediaPustakaUtama.

K em e n t e r i a n P e n d i d i k a n d a nKebudayaan. 2013. Pelangi .Jakarta:Kemdikbud.

K em e n t e r i a n P e n d i d i k a n d a nKebudayaan. 2015. Pelangi .Jakarta:Kemdikbud.

Yayasan Ke luarga Batam. 2014 .Modernisasi dan PenguatanPelayanan . Batam. YayasanKeluargaBatam.

a g u s r i a y a n t o 8 6 . b l o g s p o t . c o . i dakses/25/07/2016/23:27.

dokumen.tips/documents/program-kerja-kegiatan-ker.html.

esempe4padaherang.blogspot.co.id/p/blog-page-19.html.

h � p : / / s o b a t b a r u . b l o g s p o t . c o m /2009/03/pengertian-inovatif-kreatif-dan.html)

http://brainly.co.id/tugas/2739877

www.smakornita.sch.id/index.php.

smpn5muntok.blogspot.co.id/2014/11/program kerja-ekstra-kurikuler-kir.html.